C'est la vie

Irrtum und Wahrheit

Vorabinfo:

Die Deutsche Telekom wies mich darauf hin, daß neue Datenschutzgesetze in Kraft getreten seien und darauf hinzuweisen ist, daß

1) Die Telekom sog. "Webschriftarten" im Rahmen ihres Programms "homepagecreator" anbot und anzugeben ist, daß diese Schriftarten von dritter Seite, in diesem Fall Fa. Google, dazugeladen werden. 

Anmerkung von mir: Würde ich das vorab gewußt haben, hätte ich auf diese Schriftarten verzichtet, da ich, im Rahmen meines Berichts und meiner Überlegungen im Zusammenhang mit dem Lebensweg des Mr. Mahesh, zur zu beachtenden Möglichkeit/Alternative kam, daß Mr. Mahesh lediglich wegen der finanziellen Interessen Anderer, davon abgehalten wurde irgendwann -spätestens ca 1973/1974 - seinen ursprünglichen Lebensweg als wohlanständiger Sadhu im Gangestal - von Hardwar flußaufwärts - wieder auf nehmen zu können. Insofern muß ich bemüht sein, direkte oder auch indirekte finanzielle Interessen Dritter, wie etwa der Fa. Google von meinem  "Bericht" fern zu halten. Ich darf und will hier weder für die Fa. Google noch gegen sie Reklame betreiben. Analoges gilt für andere Personen und Organisationen. Ich bitte darum, dafür Verständnis zu haben, da sonst eine objektive, faire Auseinandersetzung mit diesem Thema nicht möglich wäre.

2) Die Telekom im Rahmen des Gästebuchs die evtl eingereichten Beiträge  zwischenzeitlich - ausschließlich zur Weiterleitung - irgendwie speichern muß, um sie an mich weiter leiten zu können; es findet allerdings keine dauerhafte Speicherung derselben statt.

Anmerkung von mir: Ich sehe darin kein Problem, werde aber anscheinend dazu extra einen Vertrag mit der Telekom zu schließen haben, wonach sie das soll dürfen. Ich muß mich dazu erst noch besser informieren und schlimmstenfalls muß ich eben auf jenes "Gästebuch" am Ende dieser homepage, auf Seite "Home, verpfuschtes Leben" verzichten.

3) Die Telekom, soweit ich das aus ihren Darstellungen entnehmen konnte, auch  im Rahmen dieser homepage sog."Cookies" gebraucht.

4) Woran es lag/liegt, daß die homepage nun, ca Juni/Juli 2018, eine Weile nicht erreichbar war, weiß ich (noch) nicht. Das war - leider - auch während der Zeit des G7-Gipfels auf Schloß Elmau so gewesen. Ob ich jene "Wartungsseite" ein- oder auch ausschalte - was ich soeben ja testete - hat/hatte keinerlei Einfluß auf die Verfügbarkeit im Netz. Sorry, ich hab das wirklich ausprobiert! Ich wurde von der deutschen Telekom auch nicht drauf hingewiesen, daß sie - aus welchen Gründen? - abgeschaltet worden sei.




Der Autor: 

Franz Rickinger, geb. 1952.   

Studium der Mathematik mit Nebenfach Physik an der Technischen Universität München, abgeschlossen mit Diplom.

Im Abiturjahr mußte sich der Autor wegen eines, vom Gymnasialprofessor im Fach Deutsch, ausgewählten Themas für das Pflichtschulreferat - einer Schulaufgabe gleich bewertet -  auf die TM-Scene  leider einlassen; das wurde dort dann teils absichtlich, häufig versehentlich missbraucht und so konnte man Ihn bis zu seiner Volljährigkeit 2 Jahre lang in die Irre führen, dann brauchte Er ebenfalls ziemlich genau 2 Jahre um wieder auf den eigentlichen Lebensweg zurückkehren zu können, was dann aber staatlicherseits - Fehlern und Täuschungen Dritter erlegen - gewaltsam vereitelt wurde. So zeigte sich, daß die vom Autor im Herbst 1970 getroffene Entscheidung, TM nicht anzufangen - jedenfalls nicht zu diesem Zeitpunkt und nicht in dieser Situation - und sich auf die TM-Scene nicht näher einzulassen, völlig richtig war, wohingegen der Schuldruckmittelmissbrauch jenes Lehrers zu unvorhersehbar gewesenen Gefahren, massiven sozialen Nachteilen und irreparablen Schäden leider nunmal dann führte.

Inwieweit ich "TM", jene sog. "transzendentale Meditation", irgendwann mal von mir aus, nach Erreichen der Volljährigkeit, erlernt haben würde oder auch mich evtl. mal zu Shankaracharya Shantanand (,der aus der Sicht von seinem Vorgänger Shankaracharya Swami Brahmananda Saraswati eh ein kompetent-genuger, offizieller Ansprechspartner gewesen sein würde,) - betreffs des Themas Meditation, Atman, Brahman usw - mal urlaubsartigerweise begeben haben würde (...sich anzubietenderweise nach sehr zügigem, erfolgreichem Studiumabschluß..) kann ich nicht sagen, da es jener fehlleistende Lehrer absurderweise vorzog alles durcheinanderzubringen und sich mit den, Ihm leider verfügbar gewesenen, lehrerlichen Druckmitteln tolldreisterweise in Dinge einzumischen, die ihn nicht einmal nur nichts angingen. Damals wurde mir nunmal TM aufoktruierenderunweise gelehrt und ich behalf mir mit dem äußersten Maß an Objektivität und Unvoreingenommenheit, dessen ich seinerzeit aufzubieten fähig war; ich machte dann so meine Erfahrungen, sammelte Informationen und erwarb das eine oder auch andere - zweifelsohne wirklich nicht grundsätzlich unerfreuliche bis hin zu gar vorzügliche - Wissen zu jenem Themenbereich, was aber aufgrund der mitunter bisweilen fanatisch-christlich, aber auch fanatisch-,radikal-,totalitär-,inquisitionär-psychiatrisch verhafteten Gesellschaft lediglich neue Konflikte, Missverstehenwollen-Möglichkeiten, Neid und deren desastreusen Folgen heraufbeschwor.

Der Autor wurde 1973 in Playa la Antilla/Spanien, März bis Mai, im Rahmen seiner Freizeitaktivitäten TM-Lehrer, arbeitete nie Vollzeit als TM-Lehrer und lehrte insgesamt ziemlich genau 100 Personen - ohne eigene Initiative - "TM". Er besuchte zahlreiche mehrwöchige TM-Lehrerfortbildungskurse und zog sich im Frühjahr 1976 aus allen TM-Aktivitäten zurück, da auf der Basis seiner - per der Fortbildungskurse und damals nur so erlangbar gewesenen - detailierteren Kenntnisse, davon auszugehen Er nicht umhingekommen war, dass die TM-Scene linksradikal unterwandert worden sei und es Ihm daher selbst als sinnvolle "Freizeit-Aktivität" ungeeignet erschien. Diese Einschätzung wurde ca 4 Jahre später unabhängig in einem US-Interview von dem früheren KGB-Mitarbeiter, Herrn Juri Bezmenow, bestätigt. Es stellte sich obendrein heraus, daß Herr Bezmenow bereits im Herbst 1970 in die USA geflüchtet war und sich dem CIA gestellt hatte, sodaß den Westbehörden jene Problematik mit der TM-Scene bekannt gewesen sein sollte.

Ende Juli 2018 bestand ich die Prüfung zum Cambridge-C1-Zertifikat bzgl die Englische Sprache


Franz Rickinger lebt in München.



Vorbemerkung 1:

In  den beiden klassischen Epen Indiens - auf der Basis historischer Personen oder auch historischer Ereignisse - , dem Ramayana und dem Mahabharata, gibt es jeweils 2 Teile, die üblicherweise auch als Einzelwerke betrachtet werden: Das "Yogavasishta" - davon gibt es drei unterschiedlich lange Versionen - und "die Bhagvad Gita". Diesen beiden ist gemeinsam, dass ein "Held" durch eigenes Tun in eine Situation der Handlungsunfähigkeit, in der sie weder vor noch zurück konnten, gerieten. Im Falle des "Yogavasishta" verdankt der Prinz Rama der Anwesenheit des Hofweisen Rishi Vasishta, daß er seine eigenmächtige, unvorbereitete Pilgerreise nicht mit dem Leben bezahlte; im Fall der Bhgavad Gita ist der weise König Krishna - als Inkarnation Gottes verehrt bzw sich später auch offenbarend oder auch nur jene Thematik bzw Problematik der Frage nach der Möglichkeit einer Inkarnation Gottes als Mensch aufgreifend und lehrerartigerweise bearbeitend - zur Stelle.

Angesichts dieser literarischen Verfügbarkeit jener Problematiken sollte es vermeidbar sein, selber mal - im Zusammenhang mit einem "esoterisch-spirituellen" Weg - in so eine Situation zu geraten (...bzw per "Lehrangeboten", die mit Inkompetenz verbunden sind,  gebracht zu werden..). Im Vorraum einer Kirche (Michaelskirche in München, betreut von "Jesuiten") las ich mal den Anspruch der r.-kath. Kirche, der da wie folgt als Slogan formuliert war:(...Entscheide Dich für ein..) "Christliches Leben, aufdaß das Leben gelingt"; man scheint sich daher auch dort der Problematik/~en bewußt zu sein. Auch Johann Wolfgang von Goethe bemühte sich etwas um jenes Thema und man findet in seinem 2-bändigen Werk "Faust" als Ausgangspunkt, die Verzweifeltheit eines Herrn namens Faust, der dann - aufgrund seiner Unfähigkeit zu vorausschauendem Denken und aus purer wissenschaftlicher Gier, aus blindem Ehrgeiz dem Bösen verfällt, für den Ausgangspunkt von "Faust II" - jener  sehr großen Verzweifeltheit, Ratlosigkeit - selbst verantwortlich, nur sich selber die Schuld geben kann  und erst am Ende des zweiten Bandes formuliert Goethe dann als Ergebnis - nachdem es im Band I darum ging, wie und daß jener Herr Faust Tod und Verderben über Andere gebracht hatte,  insbesondere über das Gretchen, ihr Baby, ihre Mutter und deren Bruder  -: "´Wer immer strebend sich bemüht, den können wir erlösen", wo dann nicht mehr jene Gier nach Wissen und Können  den Ton vorgeben konnte. (....allerdings ist "Sümpfe-Trocken-Legen" eben - aus heutiger Wissbarkeit heraus - auch noch nicht gut-genug, dh so gut als eben gut möglich - und insofern "gut-möglich" - gewesen....). In Tibet gab es mal einen bedeutenden Yogi namens Milarepa (s. jenes Buch "Milarepa, Tibet's großer Yogi",von W.Y. Evans-Wentz O.W.Barth-Verlag 1989; - ISBN 10: 3502651914/ ISBN 13: 9783502651918? - ), der erst "schwarze Magie" betrieben und eine schlimme Naturkatstrophe ausgelöst hatte (...vgl. Klimakatastrophe, Vernichtung der tropischen Regenwälder, Artensterben, Ozeane "leer""gefischt" und - stattdessen? - mit Plastikmüll angereichert, radioaktiver Unrat, Atombombenabwurf usw und nun schickt man sich an andere Planeten, Asteroiden, etc  in der selben Unweise "auszubeuten", dh zu verwüsten...), sich dann dem Streben nach Erleuchtung widmete und schließlich, nach einem Weg großer Entsagungen, Entbehrungen, sehr strenger Askese, die Erleuchtung fand.


Vorbemerkung 2:

Meine Rezensionen bei Amazon kann man via folgendem aktivem Link erreichen: https://www.amazon.de/gp/profile/amzn1.account.AHBS6EGTC2JLHF5UECOKY2K2UFNQ?ie=UTF8&ref_=ya_d_l_profil



Vorbemerkung 3:

Jegliche Kommerzielle Verwendung meiner Texte und Bilder ist untersagt; Copy Right by Franz Rickinger, München.



Vorbemerkung 4:

a) Im Rahmen meiner Recherchen stellte ich mal fest, daß in zB YouTube bisweilen bei zB gesanglichen "Zusammenbasteleien und Veröffentlichungen" im kaum bis nicht hörbaren Bereich, zumindest anscheinend, irgendwelche Aufforderungen verbaler Art "eingebaut" oder auch von Dritten hinzugefügt schienen, so wie etwa ein kaum hörbarbares "join us" (auf Deutsch: "Schließe Dich uns an").                    

b) Allgemein kann man solchen Problemen - ebenso wie der Datensammelei der YouTube-Betreiber-Firma & co wohl nur auskommen, indem man sich die betreffenden Titel der MusikerInnen bei seriösen Handesunternehmen kauft (....so wie man dem Problem einer "Extemporale"  - unangemeldete Kurzarbeit - in der Schule nur auskommen kann, indem man sich auf jede Schulstunde sorgfältig vorbereitet...); dann ist das Ganze bis zur Musik-/ Gesangsgruppe/den SängerInnen nachvollziehbar und jene haben dann, wegen der staatlichen Situation, ein gewichtiges Argument, Formen von Musikmißbrauch etc nicht zu tätigen.

Ein allgemeines Problem dabei wäre, daß verbotene Arten der Werbung irgendwelche evtl Minderjährige in irgendwelche Scenen bringen, von einem vernünftigeren Lebensweg abbringen könnte, Eltern damit absolut nicht einverstanden sind und dann von idiotischen PsychiaterInnen die Ursache dafür zwangsweise in geschlossenen psychiatrischen Abteilungen, jener Sonderform von Foltergefängnissen, in der sog. "Psyche" jener Opfer gesucht werden könnte, wobei die Ursache doch dann offenbar ganz außerhalb bei Handlungen Dritter zu suchen gewesen sein würde.

Das auch als allgemeine Warnung betreffs illegaler "Downloads".


Bei Hinweisen auf gesanglich-künstlerische Darbietungen des einen oder anderen Themas, verweise ich daher auch auf Quellen, wo es möglich ist solche "Songs" käuflich zu erwerben. Das ist nicht als Werbung gedacht; weder als Werbung für jene KünstlerInnen und was sie sonst noch so alles anbieten, noch als Werbung für jene "Plattformen"; andererseits heißt es auch nicht, daß ich Wertschätzung für den/die/zwi einen/eine/ön oder auch anderen/andere/andös Künstler/Künstlerin/Künstlzwi bzw deren Werk und Anliegen -  grundsätzlich oder auch in Teilen - für unangebracht hielte.

c) Daß es sich bisweilen - wie im konkreten Fall - nur darum handelt, daß im Rahmen einer Live-Veranstaltung, ein "join us" eingefügt erscheint, weil die Anwesenden herzlich eingeladen wurden, mitzusingen, schrieb mir, dankenswerterweise, Frau Deva Premal bzw ihr Team. Für diesen Hinweis danke ich gerne, freundlich und ausdrücklich. (zum Nachvollziehen:  https://www.youtube.com/watch?v=DG5lgpNnia0 ,bei ua.(!) ca Minute 6.55)


d) Eine Verantwortung für Link-Angaben meinerseits kann ich - selbstverständlich - nicht übernehmen; ich begnüge mich mit wenig Link-Angaben und nur bei wenigen Link-Angaben genügt ein bloses D'raufclicken.

 

der Autor als Kind im Fasching
der Autor als Kind im Fasching




Diese homepage ist erreichbar via:

www.franz-rickinger.de  und außerdem per http://wl107kzke.homepage.t-online.de

An einer verbesserten Variante meine homepage, dann mal erreichbar via            "www.franz-rickinger.eu" arbeite ich noch; das wird wohl noch etliche Monate bis Jahre dauern.

Diese Abhandlung ist nicht für Minderjährige gedacht, obgleich mir das damals alles von einem Lehrer einer staatlichen Schule zugemutet wurde, als ich noch 2 Jahre lang minderjährig gewesen war.


 - der folgende Teil wird gerade - ab 23.6.2017 -  überarbeitet, va neu strukturiert und dann ergänzt; Vieles ist mir bereits gelungen, Vieles bleibt noch zu tun. Seit April ließ ich es etwas ruhen, da ich mich bemühte, per Vorbereitungskurs auf das schulunabhängige Cambridge Zertifikat C1 und Prüfungen im Juli, zu klären "wie wenig weit oder auch weit es" mit meinen Englischkenntnissen her ist.

Nunja, Ende Juli 2018 hatte ich nun die Prüfung zum Cambrdige- C1-Zertifikat und ich habe die Prüfung wenigstens bestanden. Ich sollte wirklich noch das C2-Zertifikat machen, um auch meinen LeserInnen noch mehr Zuverlässigkeit bzgl meiner Englischkenntnisse bieten zu können.


Inhalt: 

Thematik 1:

0)    ad: TM-Hintergrund,Basis


                  1) Vasishta

                 2) Shakti

                  3) Vyasa

                 4a) Narada:

                  4) Yajnavalkya

                  5) Janaka

                  6) Shukadeva

                  7) Gaudapada

                   8) Govinda

                   9) Shankara

                      a) Chidananda, Deva Premal-Darbietung  (Übersetzung ins Deutsche)

                      b) Chidananda (andere Englischübersetzung, übersetzt ins Deutsche)

                      c) Kleinod der Unterscheidung

                      d) Bhaja Govdindam (Übersetzung ins Deutsche, siehe auch unter Swami                                                            Brahmanda Saraswati)                                                 

                      e) Bhavani Ashtakam 


                   10) Swami Brahmanda Saraswati:

                         a) 'Narmada Ashtakam', übersetzt ins Deutsche

                         b) 'Shri Charpata Panjarika Stotram' ('Bhaja Govindam), übersetzt ins                                                                   Deutsche

                         c) Uma Maheshwaram Stotram

                         d) Shri Shankaracharya upasdeshamrit, zusammengestellt und

                              herausgegeben von Swami Shantanand Saraswati


                   11) Swami Shantanand Saraswati:

                                a) Shri Shankaracharya upasdeshamrit   (1993 von Mouni ins

                                   Englische fertig übersetzt; 1980 mit der Übersetzung begonnen)

                                b) sayings of Swami Shantanand, übersetzt ins Deutsche

                                c) Eine umfassendere Korrespondenz mit Swami Shantanand                                                 Saraswati, allerdings auf Englisch, findet man zB bei:

                                 d) ) Im Buch "Celebrating the Dawn" schreibt Robert M. Oates, ein                                        wenig zu Shankaracharya Shantanand


                    12) Mr. Mahesh Prassad Varma, der von AnhängerInnen als                                                     Maharishi Mahesh Yogi bezeichnet wurde

                    13) Tat Wale Baba

                    14) einige Ausführungen meinerseits:

                    15) Einige von Mr. Mahesh's Ansätzen zu jener Thematik:

                    16a) Shiva Sutren, - "4.Hauptbewußtseinszustand" & Keith Wallace            

                        b) Kālī Karpūrādi-Stotra                

                      17) Menschenrechte, "Kastensystem", einiges Allgemeine und Konkrete                                  zum Thema Yoga - auch im Zusammenhang mit der sog. TM-Scene 

                     18) Kurzer Hinweise zu einer Upanishade und Kamasutra

                     19) Patanjali

                     20) Buddha              

                  21)  Ergänzungen - ua - wegen des allgemeinen Hintergrunds, wenn man                                 auf TM zB im abendländischen Kulturkreis stößt bzw es in jenem                                     Umfeld  damit zu tun hat:

                    21a) René Descartes 

                    21b) Jesus Christus

                    21c) Moses und die 10 Gebote .....

                    21d) Krishna         

                   22 Seriöse Lehre versus "Guruismus" ; "Guruismus" versus seriöse Lehre



I)     ad: TM, TM-Mantren 


            1) Allgemeines:

            2) TM-Mantrenlisten als Basis für die Suche nach deren                                                        Ursprung,Vorkommen, Hintergrund und "Wesen"                                               

            3) erste gefundene klassische Textangabe zu einem jener  sog. "TM-  Mantren"  

                  a) Saraswatistotra, teilweise                                                                               

                  b) Saraswatistotra allgemein, Sir Avalon alias John  Woodroff:

           4) Mr. Mahesh ad TM auf einem "ATR-Kurs" (advanced teacher training course, -                so weit ich mich erinnere - in Arosa/Schweiz im Hotel Prätschli gehalten                          worden und zwar im ca März oder auch September 1974): Transzendieren va                    Geschmacksinn statt via Gehörsinn mittels Mantra sollten TM-LehrerInnen                      auch können.

           5) Tantra der Liebe von Asheley Thirleby:

           6) Zusammenschau ausgehend von 1) bis 5):




II)   ad: TM-Lehrmethode, Initiationszeremonie


1) Puja im Rahmen des 7-Schrittekurses zur Erlernung der Transzendentalen Meditation

  a) Meinung von "Sekeninfo nrw":

  b) Darstellung des Mr. Mahesh und der "TM-Scene":

  c)  Anmerkungen von mir zur Klärung:
       unabhängige Quelle ad "Guru-Puja", "Verehrung des Guru versus                                     GöttInnenverehrung"

  d) Ad Verehrung von Persönlichkeiten der Sprache/Literatur, "Meistern der                            Mathematik", usw.

        i)   in Schulbüchern

        ii)  per Denkmälern

        iii) erster Kommentar zur "Puja"


2) Wie weit darf Menschenverehrung im Abendland christlich-kirchlich anerkannterweise offenbar gehen?

a) Karl der Große

b) "Bambie"-Verleihung 2017, Preis von Aachen udgl

c) Parallel dazu "Guru-Puja" und Schlußfolgerungen                                                                         

d) A Propos Betrachtungsweise

e) Zurück zum Thema, Zwischenfazit:



3)  Wie steht es mit dem "Ritual" korrekten Zitierens in wissenschaftlichen Publikationen?

a)  Allgemeines, aber auch Cosmia Shiva Hagen versus Guru Naryana, Guru Brahma

b) Unterlassene oder auch mangelnde Informationen in den Informationsvorträgen über        Transzendentale Meditation (TM)

c)  Informationen alà Reiseführer

d)  Gebet in Schulen und TM-Puja


4) Geschichte als Zugang zu einem Wissensgebiet:


5) Puja, Shakti gewidmet, in einer speziellen tantrischen Zeremoni; der Unterschied             zwischen GöttInnen-Verehrung und Guru-Verehrung:



III) ad: TM-Organisationen                                                              

            1) international                                                                                                        

              2) national



IV)  ad: Urteil des Bundesverfassungsgerichts ad TM und Kritik daran



V)  Wie es dazu kam, daß ich nicht umhinkam, mich genauer mit TM zu befassen - sachlich, losgelöst vom Rest und zusammenhängend.



VI) Gästebuch




Thematik 2:

Mr. Mahesh's Geschichte bzgl seiner TM-Aktivitäten

1) auf Englisch

Mr. Mahesh&TM in  English


2) auf Deutsch

Mr. Mahesh&TM auf Deutsch


Thematik 3:

Überlegungen bzgl Ursache des "Bösen" und gut-mögliche Lebensweise


Thematik 4:

Traum, Wirklichkeit, Unwissenheit


Thematik 5:

schlichtweg Mathematisches

Mathematik umfaßt viele Teil-Gebiete; zB Geometrie, Zahlentheorie, Mengenlehre, Algebra, lineare Algebra und analythische Geometrie, numerische Mathematik, Topologie, Funktionalanalysis, Funktionentheorie, Maß- und Integrationstheorie, Wahrscheinlichkeitsrechnung&Statistik, Nicht-euklidische Geometrien, euklidische Geometrie, lineare, quadratische, kombinatorische und nicht-lineare Optimierung; es gehören  jedoch auch Entscheidungstheorie und Vektoroptimierung dazu.
Sehr wohl darf man sich überlegen, was eine sinnvolle Strategie im Umgang mit der Natur, der Welt, Gott usw sein würde. Man kann sich so eine wenigstens einigermaßen vernünftige, nicht völlig absurde und in eine gänzlich falsche Richtung führende"Gesamtstrategie" suchen.

Selbstverständlich stellt sich dabei die Frage inwieweit es so eine Gesamtstrategie überhaupt gibt oder aber auch ob es evtl mehrere brauchbare "Lösungen" für diese Fragestellung gibt.

Für Pythagoras war zB klar oder auch selbstverständlich, daß die Harmonie der Welt - und damit ein Lebensstil in Harmonie mit der Welt und den Geschöpfen (seine AnhängerInnen lebten deshalb ua vegetarisch) an den Anfang zu stellen ist. (siehe   50 Klassiker, Religionen, Gerstenberg-Verlag, Peter Köhler, ISBN 978-3-8369-2617-1). Nunja, das erinnert an die "yogischen Lebensideale", an jene "8 Aspekte des Yoga", wie ahmisa (=Gewaltlosigkeit), aparigraha, brahmchary, yama, niyama, samadhi,... (s. Patanjali  Yogasutren) aber eben auch an die Eigenschaften des Zustands des Yoga. Wahrhaftigkeit (Satya), Gewaltlosigkeit (Ahmisa), Freiheit von Habgier (Asteya), "Ehelosigkeit" (Brahmcharya), Nicht-Annehmen fremder Besitztümer (Aparigraha) (siehe Maharishsi Mahesh Yogi, Bhgavad Gita, zB Deutsche Übersetzung erschienen 1971, S. 466, "Privatverlag" SRM publications, damals leider noch ohne ISBN-Nummer)

Sollte es so eine solide Gesamtstrategie geben, gilt dann, verständlicherweise:

Kann man es dann der Mathematik recht gemacht haben, wenn man irgendwas ausrechnet oder auch per irgendeiner der Teilgebiete als Ergebnis erhielt, das aber gesamtstrategisch betrachtet schlichtweg unbrauchbar ist?
Offenbar nein.

Gerade das ist das Problem mit den Naturwissenschaften. Sie rechneten zwar, machten Statistiken, usw; aber die Lebenssituation auf der Erde verschlechterte sich ständig.
Mathematik ist ein Ganzes und wenn man es nur einem Teilgebiet recht macht, aber gesamtstrategisch eine Umsetzung so eines Ergebnis, eine Gebrauchmachung von so einem Ergebnis Unfug wäre, so hat man es der Mathematik eben nicht recht gemacht gehabt. Letztendlich hat man sich dann dennoch verrechnet gehabt.


Ein sehr einfaches Beispiel ist zB die "Entdeckung Amerikas durch Coloumbus". Coloumbus ging wie Pythagoras (jene Theorie stammt nämlich von Pythagoras) davon aus, daß die Erde eine Kugel sei; insofern käme Er doch am Ausgangspunkt wieder an, wenn er immer in dieselbe Richtung, nach Westen, segeln würde. Erathostenes hatte aber schon vor Christus den Erdumfang mit Mitteln der Wechselwinkel & co sehr (Siehe zB Seite 73 in Realschule Bayern. Mathematik II/III, Westermann-Verlag, Autoren Christa Englmaier u.a., 2011, ISBN 978-3-14-121761-2) genau berechnen können. Nachdem Columbus aber seine Segelgeschwindigkeit und Aufzeichnungen seiner Messungen ziemlich genau bestimmen konnte, wäre es Ihm möglich gewesen sicher zu wissen, daß er noch nicht in Indien gewesen sein hatte können, als Er erstmals auf Land gestoßen war. Es gab die kugelgeometrische Überlegung von Columbus einerseits und die Überlegungen anhand der Querschnittsfläche der Kugel, dem Kreis, durch Erathostenes andererseits. Diese 2 Sachverhalte zusammenzubringen war sowohl für Coloumbus als auch jene, die Ihm damals seine Reise genehmigt hatten schon zu viel gewesen. Eine solide, seriöse Gesamt-Strategie hatten Columbus und jene, die seine Reise genehmigten, wie die nachfolgenden Ausrottungsaktionen an den IndianerInnen und Umweltzerstörungen zeigt, auch nicht. Pythagoras hatte "Harmonie" an den Anfang gestellt und so verstieß Columbus auch gegen die Intention von Pythagoras. Er wollte es einfach haben und die Zerstörung Amerikas resultierte. Dieses Beispiel zeigt auch, daß man es bei einer "Strategiefindung" einfacher, leichter hat, wenn man einfach mehr weiß. Es wäre wohl kaum zu viel verlangt gewesen von Columbus die Kenntnis der "geometrischen" Berechnungen von Erathostenes vorab einzufordern, nachdem diese sogar offenbar in unmittelbarem Zusammenhang zu dessen Vorhaben standen. Na klar, gab es aus den Reihen der damaligen Kirchenkreise auch schlimme, inakzeptable Widerstände gegen Wissenschaft und selbst gegen Mathematik, sodaß  Überlieferungsprobleme teils auch beabsichtigt gewesen waren.

Ein ähnliches Beispiel sind die "Benutzungen" gemachter Statistiken bzgl Auswirkungen der Ausübung von TM; also "verringerter Drogenmißbrauch", "weniger Alkoholkonsum", usw. Alles (zumindest mehr oder auch weniger) schön brav gemacht, als Diplom-und PhD-Arbeiten usw abgesegnet worden. Als Gesamtkonzept hatte man erst die "Nachprüfbarkeit" durch eigene TM-Ausübung. Dann kam die 1%-Statistik und was tat man? Man warf das "Gesamtkonzept" der "Nachprüfbarkeit durch eigene TM-Ausübung" (...ein Prinzip das auch René Descartes forderte, wenn Er überlegte, wieso etwas ein Beweis sein solle, wenn man etwas auf Aussagen von Aristoteles oder Hl. Augustinus odgl zurückführen habe können, wo sich jene doch schließlich auch geirrt gehabt haben könnten...) über Bord. Außerdem mißachtete man, daß TM-Ausübung eben Auswirkungen hat, wie es aus der Tradition des Yoga und Tantra her bekannt gewesen sein hätte können und zumindest sollen. Man wollte es evtl ja auch nur nicht vorab dazusagen, daß "Gewaltlosigkeitsambitionen", usw dann auch daherkämen , so wie der ganze Tisch herbeikommt, obgleich man nur an 1 einzigen Tischbein zieht. Nunja, Letzteres war Mr. Mahesh dann irgendwann aufgefallen oder auch wieder eingefallen und so wurde es zu einem späteren Zeitpunkt (ca 1973) halbherzig kommuniziert und eher dem Zufall überlassen, daß irgendwelche TM-LehrerInnen irgendwelchen TM'lerInen das dann irgendwann und irgendwo schon noch - nachträglich - würden mitteilen. Man sieht, daß es gerade im Bereich Yoga & Tantra ja eine "Gesamtstrategie" - aus der Tradition, aus Überlieferung  - gegeben haben würde und es evtl ja nur darum gegangen wäre ihre "Sinnvollkeit", "Brauchbar-genug-keit" vorab einzusehen und das Verständnis derselben den zukünftigen TM'lern vorab abzuverlangen; zumindest hätte man dann deren Falschheit zu begründen gehabt, wenn was man nicht tat und evtl ja auch niemals gekonnt haben wüde So vermochte man das Zusammenspiel von eigener Nachprüfbarkeit und "Statistischen Untersuchungen an Anderen" durch Andere nicht vernünftig "strategisch" bewältigen. Man machte es der "Mathematik" eben nicht umfänglich recht, wenn man TM-AnfangerInnen die halbe Wahrheit verzählte und der Lebensweg der dabei dann herauskam schließlich alles Anderem als einer vernünftigen Strategie entsprach. Na klar hilft's nicht, der Welt zu verzählen, daß Buddha Erleuchtung erlangt habe und Erleuchtung dies&jenes, lt. desen Aussagen, sei und gleichzeitig hat man selber nicht Erleuchtung erlangt und glaubt's halt nur, weil Buddha's "persönliches Zeugnis" einem glaubwürdig erscheint. Na klar, man hat ja evtl. die Infos korrekt weiter-überliefert, mitgeholfen sie durch die Zeit zu tragen und irgendwann kapierte es evtl ja wer, daß man das selber erlangen könne, sollte und daß es darum gegangen war bzw wäre. Das ist so wie wenn jemand eine allte landkarte von Generation zu Generation weitergibt und immer wieder wird sie in Ehren gehalten, bis schließlich jemand dann mal merkte, daß jener komische, doch im Vergleich zu aktuelleren Karten, falsch eingetragene Punkt der Lage eines "Schatzes" entsprach; das "Überliefern" der Karte mag ja dann so einen Sinn gehabt haben, wenn jener die Möglichkeiten aus dem Schatz dann wiederum gesamtstraegisch sinnvoll handhabte. Man sieht schon, daß es eben nicht egal ist, was man überliefert. Überliefert man etwas, was man nicht mißbrauchen kann und wo jemand der es mißbrauchen will, sich allenfalls selber in Schwierigkeiten bringt, so ist man "so olala fein" heraus, wenn man das dann noch vorab dazu gesagt haben sollte. Überliefert man Mißbrauchbares, wo am Ende allenfalls noch sowas wie ein "allgemeines Gesetz des Karama", falls es das denn geben sollte, als "Ausrede" hätte, sofern es jemand mißbrauchte, hat man doch nicht gesamtstrategisch vernünftig gehandelt. Denn wenn man echt gewüßt hätte, daß es so ein Gesetz des Karma, auf das man sich da ja letztlich blindlings verlassen hatte, tatsächlich gibt, so würde man doch jenes Überliefern unterlassen haben.

Kann es "vernünftig" gewesen sein, wenn man hinterher feststellt, daß man etwas keinesfalls hätte getan haben sollen? Oder auch wenn man mal meinte es sich so&so bequemer, einfacher zu machen bzw machen zu können und hinterher wurde alls nur noch unbequemer und komplizierter als es zuvor einst gewesen war?


Im Schulbuch für Gymnasien in Bayern, 12.Klasse, G8-Gymnasium, Lambacher Schweizer, Klettverlag, ISBN 978-3-12-732860-8, findet man auf den Seiten 174 und 175 allgemeine Hinweise bzgl "Strategisch vorgehen". Darunter findet man "Rückwärts arbeiten", "Betrachten des Gegenteils" (auch in den Patanjali Yogasutren kommt "Meditation über das Gegenteil" an einer Stelle vor), Betrachten eines Extremfalls, Fermi-Strategie, Invarianzprinzip (Nunja "Nitya Samadhi" ist, wie der Name "Ewiger Samadhi" schon sagt etas Invariantes, wenn man es erst mal erlangt haben sollte; siehe Patanjali Yogasutren), usw. Auch im Englischbuch für Realschulen in Bayern las ich mal einen Hinweis ad "Lernstrategie". Diese einführenden Hinweise zur Verdeutlichung der allgemeinen Akzeptanz der Problemstellung an sich. Dabei wird "Betrachten des Gegenteils" offensichtlich praktiziert bzw beherzigt, wenn man im "2-Personen-Nullsummenspiel" ("Spieltheorie") das MINMAX-Prinzip zur Lösungsfindung benutzt. Was passiert im "ungünstigsten Fall", was passiert wenn ich mich, angesichts Nicht-Gewußtem, blöd entscheide oder, allgemein gesagt, eine unvernünftige, wenig sinnvolle Wahl aus meinen möglichen  Entscheidungen treffe?

Wenn es im obigen Schulbuch von Lambacher und Schweizer heißt "systematischens Probieren" ist mitunter eine sinnvolle Strategie zur Lösungsfindung, so darf das eben nicht einfach auf Chemie, Physik, Ökologie ausgedehnt werden, da dem Chemiker das Labor um die Ohren fliegen könnte, der Physiker evtl ja in den Gasen der Erdatmosphäre, die ja allesamt zu den leichten Elementen zählen, eine Fusionsreaktion ausgelöst haben könnte die dann leider niemand auf Erde mehr stoppen könnte, die Tier-oder auch Pflanzenart, die man ausrottete oder auch "nur" dezimierte oder auch nur "verfolgte", im Nachhinein gesehen viel ökologisches Desaster erspart haben würde (Pythagoras/die Pythagoräer würde/~n da  subjektiv deutlicher geworden sein und angemerkt haben, daß der, der ein Tier ißt, riskiert seinen Freund zu verspeisen, nachdem es doch Wiedergeburt gibt/geben könnte.), der Drogenjunkey, der später clean wurde, aber dessen Gehirn/Nerven geschädigt wurden, sieht, daß er/sie/zwi Blödsinn gemacht hatte und es nunmehr -leider - nicht mehr korrigierbar ist und er/Sie/zwi sich halt mit verringerter Leistungsfähigkeit, reduzierten Möglichkeiten zufrieden zu geben hat und haben wird. Kurzum das mit dem "Systematischen Probieren" mag ja in der Mathematik bei speziellen Aufgabenstellungen - sogar bei der Suche nach Strategien  von großer Bedeutung sein (Dr. Kredler/TU-München befaßte sich in seiner Habilitationsarbeit mit einem Verfahren zur Suche nach einem Maximum, das auch noch in Fällen von Funktionen mit bis zu 1000 Variablen funktioniert; dabei wird ein "stochastischer Prozeß" aufgebaut und in jedem Schritt eine Such-Richtung nach gewissen statistischen Kriterien, also "Zufallskriterien" und im weiteren Sinen des Wortes also "Probieren" gesucht und gewählt.) - akzeptabel sein; solange man nur umeinander rechnet, tut man ja niemandem weh, außer evtl sich selber, wenn man sich übernimmt und zu sehr erschöpft.

Selbstverständlich ist zu beachten, daß sowas wie das "MAXMIN"-Prinzip in der "Spieltheorie", sog. "2-Personen-Nullsummenspiel" nur möglich ist, wenn man es mit einem Zahlbereich zu tun hat, indem es sowas wie "größer und kleiner" überhaupt gibt bzw geben kann; im Bereich der komplexen Zahlen gibt es nunmal beispielsweise grundsätzlich kein größer und kleiner, da es sich nachweislicherweise in jenem Zahlbereich nicht definieren läßt. Aber der Bereich des Handelns, des Alltags kann eben geordneter, harmonischer mit den Natur und den Geschöpfen gelebt werden oder aber weniger harmonisch wenn nicht gar disharmonisch. Man hat eben einen gewissen Freiraum des Entscheidens und Handelns und hat erfahrungsgemäß auch resultierende Konsequenzen. Möchte man Gewisses vermeiden, bedarf es eben gewisser vorherigen, geeigneter Entscheidungen.


Ich hatte in meiner Jugendzeit gerne Chemieversuche gemacht und nahezu die gesamte Freizeit - Sommer wie Winter - in kaltem Speicher oder noch kälterer Garage verbracht. Bei meinem letzten Versuch produzierte ich nen Silikon. Das erforderte feinst verteilstes Kupfer als Katalysator, welches ich mir auf chemischem Wege beschaffte. Soweit so gut. ich staunte dann nicht schlecht, als sich - mit meinem ziemlich temperaturschwachen Spiritusbrenner - im Reaktionsrohr aus Jenaer Glas dann ein Kupferspiegel gebildet hatte, den ich durch nichts mehr zu entfernen  vermochte und der mich mit seiner Schönheit tief beieindruckte. Den Siedepunkt von Kupfer vermochte mein Spiritusbrennerlein ja doch bei Weitem nicht zu erreichen, was war passiert? So war ich auf  "Nanotechnologie" gestoßen und hatte festgestellt, daß da ungeahnte Effekte auftreten können. Genau genommen hatte ich also Glück gehabt, obwohl ich alle Gefahrenhinweise aus den Chemie-Fach-Büchern gelesen und beachtet hatte. Insofern war das einer der Gründe weswegen ich mich dann für Mathematik entschied.



Ad Problematik der Naturwissenchaften, insbesondere der Versuch die Enstehung der Welt pyhsikalisch per Zufall zu erklären:

In der Zeitschrift Spectrum war ein Artikel titels "Gottes letzte Zuflucht", dazu schrieb ich einen Kommentar (https://www.spektrum.de/news/gottes-letztes-schlupfloch/1561590) und hier nun noch eine präzisierende und ergänzende Überlegung:
Meine Ausführungen in Kommentar Nr. 26, berichteten bereits, daß auf der Menge aller Teilmengen des 3-dimensionalen reellen Raums (erst recht 4-dimensional) kein einziges Wahrscheinlichkeitsmaß existiert. Der |R³ als Egebnismenge Omega; daraus eine Sigma-Algebra gebildet, feine Sache. Die Physik wird immer nur endlich oft gemessen haben können (endlich viele Physiker mit endlich vielen Lebensjahren und, lt. Vorstellungen der Physik eine endliche Lebensdauer des Weltalls); die Meßgenauigkeit ist ebenfalls endlich, u.a. weil die Physiker nunmal keine unendlich langen Zahlen pyhsikalisch hinpinseln können. Also da ist es schon sehr entgegenkomnend, daß  bei Sigma-Algebren (außer endlichen Durchschnitten auch) abzählbar unendlich viele Vereinigungen "gewährt" werden. Egal wieviel-stufig man nun so ein "Zufallsexperiment", eine Abfolge von Zufälligkeiten ansetzt, es gilt: Solche Durchschnitte und Vereinigungen ergeben immer wieder nur eine Menge jener Sigma-Algebra und eben niemals die Potenzmenge des |R³; die Physik geht bei jener These eben davon aus, daß am Anfang eine Sigma-Algebra zusammen mit einem Wahrscheinlichkeits-Maß gewesen seien. Also stellt sich die Frage nach dem "woher kommt die Vorstellung der Potenzmenge des |R³", die wohl auch Physiker im Verlauf ihres Studiums mal kennengelernt haben?  Jene These, jener "Glaube"wonach am Anfang ein Zufall gewesen, daraus wäre diese pyhsikalische Welt geworden, daraus immer komplexere Lebewesen und schließlich der Mensch mit seinem Gehirn und als Folge eines solchen "normal" funktionierenden Gehirns dann "normales" Bewußtsein, Denkfähigkeit, Vorstellungsfähigkeit usw (siehe etwa auch das Buch des Psychiaters Prof. Dr. Hoimar von Ditfurth "Am Anfang war der Wasserstoff" hieße aber: aus A (physikalische Welt) => B ( Mensch mit sog. "normal" funktionierendem Gehirn); aus B (="normal funktionierendes Gehirn)   => C  (nämlich Vorstellungen) => D (Potenzmenge des |R³); Insgesamt hat man gemäß der Transitivität von "=>" dann aber A (Zufallswelt) => D ("Potenzmenge des |R³), was aber in einem Wahrscheinlichkeitsraum nicht sein kann. "Wie durch ein Wunder" wäre man plötzlich aus der Sigma-Algebra d`raußen und die uranfängliche Sigma-Algebra, die zusammen mit dem Wahrscheinlichkeitsmaß existierte, wäre zu etwas anderem geworden, was daraus aber per Zufall nie&nimmer werden kann. Nunja, es wäre wirklich ein "Wunder", aber eben nicht "zufalls-physik-alisch möglich". Die Vorstellung der zB. Potenzmenge des |R³ könnte nicht  dem Zufall entsprungen sein; woher käme sie aber dann? Es wäre also mindestens eine geistige Vorstellungswelt gewesen, bevor die pyhsikalische Welt entstanden war, es hätte eine Welt vor der "physikalischen Welt" gegeben und wieso sollte jene enden, wenn diese pyhsikalische Welt endet? Nachdem die Potenzmenge des |R³ aber jene Menge Sigma-Algebren in sich enthält, jene umfaßt scheint's eher so zu sein, daß die "uranfängliche Sigma-Algebra der Physiker anno 2019" aus dem entstanden ist - durch eine Art von vergessen, vernachlässigen des weitaus "größeren" Restes - woraus ua die Vorstellung "Potenzmenge des |R³" entstehen kann/konnte und was nicht pyhsikalischer Natur wäre. Man käme/kommt so unweigerlich zur Einsicht, daß die Welt der Vorstellungen, der  - nicht pyhsikalisch gebundenen - "reinen" Ideen unabhängig von der pyhsikalischen Welt bestünde/besteht und es insofern eine höchst lebendige Welt, viel größere Welt als die der Physik auch bestünde/besteht und keinesfalls aus der physikalischen Welt entsprungen ist, dh auch nicht der Existenz der "physikalischen Welt" bedarf,  um zu existieren. Auch das Überlegen in jenem Bereich jenseits der "physikalischen 'Zufallswelt'", wäre Teil jener Welt und insofern könnte es rein-geistige Wesen geben, die existierten,  bevor es diese pyhsikalische Welt gab, die existieren auch wenn es dieses physikalische Welt gibt und die weiterexistieren, wenn diese pyhsikalische Welt mal aufgehört haben sollte zu existieren.

In der Mathematik spielte schon immer das eine Rolle, was mit vorgegebenen Mitteln nicht möglich ist, wie etwa beim Dehli'schen Problem, der 3-Teilung eines allgemeine Winkels mit Zirkel und Lineal (diese fanden eine Antwort per der sog. Galoistheorie welche ein Teilgebiet der Algebra ist), die Quadratur des Kreises, udgl und so zeigt sich, daß auch die Unmöglichkeit der Definition eines Wahrscheinlichkeitsmaßes auf der Potenzmenge des 3-dimensionalen reellen Raums, von weitreichender Bedeutung ist.





Thematik 1:

 0)    ad: TM-Hintergrund,Basis

 

Shankara's Parabel von Seil und Schlange, siehe etwa "Kleinod der Unterscheidung", sollte hier wohl - passenderweise -nicht unerwähnt bleiben

"Wer von Unwissenheit geprägt ist, bewertet die Dinge falsch. Er hält eine Schlange für einen Strick. Dadurch gerät  er in  große Gefahr. Er hält vergängliche Formen für die Wirklichkeit und wird deshalb von ihnen gefesselt."  

Zitat aus "Kleinod der Unterscheidung" von Shankara ( zB Bernd Helge Fritsch, ISBN 9783842363786, 2011, Verlag "Books on Demand GmbH") , S.83, Vers 83

Nunja, lt, Shankara, Vasishta und anderen ist diese Welt eine Art "Traum", "Samsara".


Auch Herr Gaudapada gebrauchte eine ähnliche Parabel "Seil versus Linie in Wasser":

In Kapitel II von Gaudapa's Karika - Vaitathya Prakarana  (Das Kapitel über Illusion,Täuschung), heißt es - die Übersetzung fertigte ich auf der Basis von 8 Jahren Schulenglisch selber an- :

17 So wie ein in Dunkelheit herumliegendes Seil, über dessen Natur man im Unklaren gelassen wird, als Schlange oder auch als Linie in Wasser vorgestellt wird, so wird Atman auf unterschiedliche Art und Weise wahrgenommen.

18 Sobald  die wahre Natur des Seils klargelegt ist, verschwinden alle Missverstände in bezug darauf und es erwächst die Überzeugtheit, daß es sich um nichts anderes als ein Seil handelt.  Ebenso wird die wahre Natur von Atman bestimmt; ebenso ist die Wahrheit über Atman bestimm-, ermittel- und entscheidbar.








1) Rishi Vasishta:

Im Yogavasishta (,Die Lehren des Weisen Vasishta, Ansata-Verlag, ISBN3-7157-0112-9) heißt es auf af Seite 20 in den letzten beiden Zeilen "Hierauf sagte der Weise, er erinnere sich, was Brahma zur Aufhebung der Samsara-Illusion gelehrt habe, und begann zu sprechen";

auf  Seite 32 in "Lila oder die Geschichte vom Mandapa heißt es ua: "Reines Erkennen ist dein wahres Wesen. Diese Welt hier ist ein langer Traum".

Siehe auch auf Seite 24 "III über die Weltentstehung": >>  Die ganze Welt, die man hier wahrnimmt, mit allem, was da steht und geht, wird - wie im Tiefschlaf der Traum - am Ende eines Kalpa [Äons] zunichte. Dann herrscht eine tiefe Stille, weder Licht noch Finsternis breiten sich aus. Übrig bleibt ein nicht beschreibbares, namenloses, erscheinungsloses Seiendes. Ewige Ordnung [rta],Selbst  [atman], Höchtes [para] , Brahman, wahre Wirklichkeit [satya], solche und andere Namen erfanden zur allgemeinen Verständigung die Weisen für dieses große Selbst.  Das nur so existierende Selbst manifestiert sich spontan als scheinbar unwissend, wird gleichsam zu einer Seele und durch Denken zu etwas Trägem [Grobstofflichem]. Als Gemüt [denkende und fühlende  Instanz] wird es zum individuellen Selbst, wie eine Welle aus dem Ozean. Von Ihm nun wird dieses phantastische Blendwerk hier, das die Welt ausmacht, ausgebreitet. Wie ein goldenes Armband als Gegenstand sich nicht vom Gold trennen läßt und das Gold nicht vom Armband, so verhält sich auch analog die Welt als Gegenstand zum Höchsten <<

Interessant ist auch im Yogavasishta, Kapitel II, der Anfang der Unterweisung, [Die Geschichte von Suka], Seite 19-20; (,Die Lehren des Weisen Vasishta, Ansata-Verlag, ISBN3-7157-0112-9).

Jenes Buch "Yogavasishta" ist Teil des großen Epos "Ramayana", welches ein Herr Valmiki verfaßte. In dem Epos geht es um die Geschichte Ramas, eines indischen Prinzen, der seine Gemahlin Frl.Sita (Tochter von König Janaka) "eroberte", als jene eine Art Wettbewerb um ihren Zukünftigen  veranstaltete und Rama als Einziger in der Lage gewesen war, die gestellte Aufgabe zu erfüllen/zu lösen. Später allerdings gab es etwas, das als "Entführung Sitas durch einen Dämon" dargestellt ist. Das klassische Ramayana endete ohne "Happy End". Nun wurde in einer Doku betreffs "Entdeckung Amerikas" in ZDF, Phönix, Arte, ZDF-History oä berichtet, daß Archäologen in Amerika antiken Schmuck  gefunden haben, der nur aus Indien stammen könne. Datiert wurde das auf wesentlich früher als "Comlumbus's sog. Entdeckung Amerikas". Nun könnte daraus geschlußfolgert werden/worden sein, daß dann wohl jemand aus Indien in Amerika gewesen sein müsse und die Entdeckung Amerikas auch von dort aus erfolgt sein müsse. Allerdings wäre  dieser Schluß falsch, da es ja auch so gewesen sein könnte, daß jemand aus Amerika Eurasien mit "Indien" entdeckt hatte, was dann lange vor Columbus geschehen war und daß jener jemand aus Amerika eben jenen Schluck aus Indien mit "nachhause" gebracht habe. Wenn man das also mal tatsachengmäß bzw logikgemäß berücksichtigt, könnte sich also Folgendes zugetragen gehabt haben: Aus Amerika landeten irgendwelche Ur-AmerikanerInnen in Indien mit einem oder auch mehreren Booten. Sie gingen an Land, sahen sich um. Zwischenzeitlich hatte sich die indische Prinzsesin Sita, die die Gemahlin Ramas bereits gewesen war, aus purer Neugierde, in falschem Sicherheitsgefühl, wonach Ihr dank Rama nie&nimmer was poassieren würde können, an Bord geschlichen, um jenes eigentümliche, fremde Boot in Augenschein zu nehmen. Nun wären zB plötzlich die EigentümerInnen zurückgekehrt, weil sie von Rama odgl und seinen Gefährten entdeckt, angegriffen und festzunehmen versucht worden waren. Eilends hätten sie ihr Boot bestiegen und wären losgerudert/losgesegelt, was das Zeug gehalten hätte. Sita hätte sich,  angesichts der drohenden UnbekanntInnen schnell-schnell, in der Absicht sich dann später von Bord zu schleichen, versteckt. Aber da war sie  evtl schon entdeckt worden, oder aber sie waren längst auf hoher See und es war unmöglich geworden. So war sie schließlich , bedrängt, unfreiwillig, ziemlich verzweifelt, verängstigt samt den Schmuck, den sie bei sich getragen hatte, in Amerika - aber dennoch am Leben geblieben und, bis auf die Strapanzen so einer Überfahrt, einigermaßen wohlbehalten angekommen.  Die Fremden, die sie vom Aussehen her eher an Dämonen, denn an Menschen erinnerte, behandelten sie nicht schlecht, gaben Ihr zu essen, Medizin, usw, so wie es die Urweinwohner Amerikas ja auch mit Columbus und seinen Gefährten getan hatten, solange Columbus nicht anfing sich deren Land etc zu rauben und sich als "Herr" zu ver-benehmen. (Es gab bis vor Kurzem/gibt auf Hawaii noch einen Hawaianer, der die Navigation mit den 5 Sinnen - also ohne Kompass & co - beherrscht und ein traditionelles hawainansiches Floß tausende Kilomenter weiter zielgenau über den Pazifik zu steuern fähig war/ist. (Da war mal nen Doku darüber in ARTE,Phönix,3Sat,ZDF, oä. Auf solchen Floßen war allerdings Sex, selbst zwischen Ehepaaren, grundsätzlich verboten, da es seine Navigationsfeähigkeiten beeinflussen könnte. Solche Sex-VeranstalterInnen wurden dann stets bei nächster Gelegenheit vom Floß entfernt. Insofern könnte es solche Disziplinregeln auch damals, bei Sita's Überfahrt gegeben haben, sodaß jenen Besorgnis, die im Ramayana eine große Rolle spielt insofern von den Fremden - zumindest an Bord - sogar völlig geteilt worden wäre.) Sita war zunehmend verzweifelt, da es Rama einfach nicht gelang sie zu finden. Aber zu ihrem große Erstaunen, ja zu ihrer Freude, fand sie in Amerika "Freunde" unter den dortigen Affen; Affen kannte sie schließlich auch aus ihrer Heimat, Jenen Affen gelang es, ihr Gemüt zu besänftigen, ihre Sorgen und Ängste einzudämmen; bisweilen vergaß sie so ihren Kummer und vielleicht sang sie ihren AffenfreundInen bisweilen die schönsten Lieder - auch vedische Lieder - aus ihrer Heimat vor. So würde denn in der Geschichte vom Affengott Hanuman, der sich zu Sita begeben habe, um sie zu retten - aus dem Samasara, jener Welt in der es auch Täuschungen, Irrtümer, Missgeschicke usw nunmal gibt/geben kann - ein sehr tiefer Sinn liegen. Vielleicht sah Sita, wie sich die Aufmerksamkeit eines Äffchens mal auf sie richtete und sie erkannte, daß auch Affen Bewußtsein, Aufmerksamkeit, haben. Vielleicht merkte sie wie sie Ihr mit Unparteilichkeit, Objektivität, Unbestechlichkeit und Unvoreingenommenheit gegenübertraten und sie erkannte, daß jener Strahl der Aufmerksamkeit auf der 3-dimensionalen Welt senkrecht stand, da Er ja völlig vorurteilsfrei allen 3 Dimensionen gegenüber zu bestehen hatte, da es sonst keine unparteiliche, objektive Aufmerksamkeit gewesen sein könnte/würde . So würde sie zur Fähigkeit gelangt sein "4-Dimensionalität" als normaler Alltagsrealität zu sehen/wahr-zunehmen und zu begreifen. Allmählich bzw auf diesem Wege würde sie evtl in aller Sachlichkeit, Objektivität, Wissenschaftlichkeit, Nicht-Verrücktheit, Normalität zu jener grundlegenden vedischen Erkenntnis des "Ich bin Das, Du bist Das, all dies ist Das" angelangt sein, auf der Basis der Liebe von Äffleins zu Ihr und ihrer Liebe zu den Äffleins. Zu einer Siddhaini, einem körperlosen Wesen allmählich geworden seiend, wäre sie irgendwann dann ihrem "Götter-Gatten" Rama, der dank der Belehrungen von Rishi Vasishata auch irgendwann so ein Siddha (vgl. Patanajali Yogasutren) geworden war, in einer Art himmlischen Siddha-Welt, wieder begegnet sein und so würde dann die Geschichte von einem göttlichen Affen-Wesen, Gott Hanuman, der zu Sita gekommen war, sie zu erretten aus ihrer - per unwissender, Art dümmlicher Neugierde - irgendwie ja schließlich auch selbstverschuldeten, tragischen Nott und sie mit viel Zeit, Geduld, wunderbarer Naturumgebung (....und einer ihr unverständlichen Fürsorglichkeit, Begierde aber auch Disziplin von komischen Wesen, die aus ihrer Sicht eher wie DämonInnen aussahen, denn wie Menschen...) erretten, aber dennoch nicht nachhause bringen konnte, zu Valmiki irgendwann gekommen sein, der sie dann als "Ramayana" niederschrieb.  Diese Geschichte "Ramayana" bietet also viel Platz für's Nachdenken, Überdenken von Beziehungen, Objektivität, Fairnessem Sachlichkeit, Wissenschaftlichkeit, Vernünftigkeit, Normalität und Verrücktheit/~en. Die Geschichte der Heiligen Kühe Indiens, der heiligen Haine der Dörfer Indiens könnte so in tieferem Sinne Entsprechungen haben zu den "Totemtieren" bei "UramerikanerInnen".


Rishi Vasishta ist auch einer der Rishis des Rig-Veda, siehe zB "RIG-VEDA", Herausgegeben und eingeleitet von Peter Michel, marix-Verlag, Band I, ISBN 978-3-86539-165-0, Siebenter Liederkreis.


deutschsprachige Literatur im Zusammenhang mit Rishi Vasishta:

Die Lehren des Weisen Vasishta, Ansata-Verlag, ISBN3-7157-0112-9

Das Ramayana, Diederichs-Verlag, ISBN3-424-00716-1, 1.Auflage 1981 ; diese Prosaversion folgt der 3-bändigen englischen Übersetzung von Hari Prasad Shastri, "The Ramayana of Valmiki. Shanti Sadan, London 1953-1959 und Neubearbeitung 1976. Ins Deutsche übertragen von Claudia Schmölders.

"RIG-VEDA", Herausgegeben und eingeleitet von Peter Michel, marix-Verlag, Band I, ISBN 978-3-86539-165-0, Siebenter Liederkreis.






2) Shakti:

Zu Shakti gibt es zB in "Große Welt des Tantra" von Mookerjee, O.W.Barth Verlag auf S.211 einen Auszug aus der Guru-Puja, wobei Shakti als "Guru" bezeichnet ist; es findet sich im Kapitel über "symbolische Vergegenwärtigung des Guru" (Jenes dort beschriebene Initiationsritual hat mit "TM" nichts zu tun; aber Guru-Puja ist Guru-Puja und es findet sich darin eben ein kleiner Teil derselben und zwar Shakti gewidmet. In der Beschreibung dazu wird ersichtlich, daß es sich um eine symbolische Vergegenwärtigung des Gurus - hier Shakti, die Tochter von Rishi Vasishta und Mutter von Parashar - handelt und um keine GöttInnenverherung odgl. In jener tantrischen Initiationszeremonie - die ich nicht als "jugendfrei" bezeichnen würde - kommt dann durchaus auch eine Göttin, nämlich Kali, vor, sodaß hier insofern sehr eindeutig zum Ausdruck kommt, daß es sich bei der "Guru-Puja" um keine religiöse Zeremonie handelt und deshalb hielt ich es für wichtig, dieses Zitat genauer anzugeben. Shakti wird hier eindeutig als "Guru" bezeichnet und nicht als GöttIn!

aus große Welt des Tantra,Mookerjee, O.W.Barth Verlag S.211


In Analogie zur jener bei einer TM-Initiation ausgeführten Puja  werden hier Blume, Räucherstäbchen, Kerze, Früchte, Betelblatt der Gurini Shakti angeboten/dargelegt.

In der vorvorletzten Zeile obigen Textes geht es um sowas wie die Darbietung/Darreichung/Hingeben einer Kerze an die Gurini Shakti.

Die vorletzte Zeile des obigen Textes heißt vermutlich/eventuell/anscheinend sowas wie "Früchte werden der Gurini Shakti hingelegt/gegeben/angeboten.

Die letzte Zeile im obigen Text heißt vermutlich/eventuell sowas wie "ein Betelblatt wird der Gurini Shakti hingelegt/gegeben/dargereicht.


Das kann man auch als symbolische Handlungen begreifen. Wenn jemand auf eine Privat-Schule oder auch private Universität geht, so ist es da durchaus üblich - ja normal - daß man dafür etwas zu bezahlen hat. Niemand bezeichnet das hierzulande als "religiösen" Akt. Letztendlich aber haben die SchülerInnen/StudentInnen die Dinge zum Unterricht mitzubringen, die der/die LehrerIn braucht, um Ihnen besser oder auch überhaupt erklären zu können, was sie ihnen nunmal zu sagen haben/lehren sollen. Die Privatschule/private Universiät finanziert sich ja nunmal aus den Gebühren; also alle dort benutzten Lehrmittel haben SchülerInnen/StudentInnen oder auch deren Eltern/Pflegeeltern/StipendiumgeberInnen bezahlt und zu bezahlen gehabt.





Daß es in jener tantrischen Zeremonie an irgendeinen Stelle dann auch um die Thematik der Identifizierung der Guruni mit einer Göttin geht, vermag einen nicht zu verwundern, wenn man berücksichtigt, daß es ja auch um "Täuschung und Wirklichkeit" und um die "Überwindung" von Täuschung, das nicht mehr Verhaftetsein in Illusion, Täuschung udgl geht. Diese Problematik bzw Thematik findet sich auch in den Übersetzungen  klassischen Literatur wieder:  Da wird zB Kali als "Vernichterin" der Zeit bisweilen dargestellt bzw entsprechende Textstellen werden so übersetzt. Im Buch "Tantra-Asana" von Ajit Mookerjee, Anton Schroll&co-Verlag Wien und München, ISBN 3 85560 029 5 heißt es zB auf Seite 115, übersetzt aus dem Mahanirvana-Tantra:

"Hrn, o Zerstörerin der Zeit,

Srn, o Schreckliche!

Krn, Du bist freigibig,"....


Nunja, "Turya" (vgl. Shiva-Sutras)  jenseits von Wachen, Träumen und Schlafen, jener Zustand absoluten, reinen Bewußtseins ist auch jenseits von Zeit. Insfern ist eine richtige, wirkliche, echte  Meditations-Methode etwas, was ermöglicht jenseits von Zeit zu gelangen. (Schon Einstein hat festgestellt, daß man es sich mit dem Phänomen Zeit nicht zu einfach machen darf.). Dort, jenseits der Zeit, angelangt, ist die Zeit gleichsam "abgeschafft", "vernichtet", "überwunden worden" und das hängt aber eben sehr vom subjektiven Blickwinkel ab. Wer unter der "Zeit" zu leiden meinte, der wird evtl dann übersetzen, daß die Zeit vernichtet worden sei, man sie endlich mal los sei. Allerdings wird man damit der Thematik nicht wirklich gerecht, da man es dann nunmal nur aus 1 Blickwinkel heraus betrachtete und dann in Widerspruch zu dem Anspruch des "allgemein-wahr sein sollen" jenes Textes gelangt. Wenn es um Initiation, um "Tantra-Asana", also den Anspruch von "Yoga-Zustand-Erlangen/~Erreichen/~Gewinnen" geht, dann spielt da auch die Thematik von momentanem "Samadhi" und "ewigem Samadhi" (....Letzteres dann also "Erleuchtung"; jemand - Er war wohl 1971/1972 Jugendschützer in Zivil für die TM-Scene in München - meinte mal zu mir, daß das so sei wie im Buddhismus mit "kleinem und großem Satori" ....) herein und im "Ewigen Samadhi" ("nitya-samadhi" - siehe Patanajali Yogasutras) wäre dann also insofern die "Zeit" endgültig "überwunden" und bei entsprechender - unpäßlicher und problematischer,  wie ich meine -  Ausgangsbetrachtung "vernichtet" worden, weil ja "Unsterblichkeit" und damit  ein "nicht-mehr-von-der Zeit zerstört werden können" erlangt worden sei. Die Unpäßlichkeit des Denkens im Begriffen von Zerstörung im Zusammenhang mit Wissen und Wissenserlangung zeigt sich in den zahlreichen häßlichen Handlungsweisen aus zB dem religiösen, aber auch psychiatrischen Lager, die immer wieder versuche unternahmen sich lästiger "Andersdenkender", "Andersseiender", etc per Ermordung, dh Vernichtung oder auch per Folter und insofern eben Persönlichkeitszerstörungsversuchen zu entledigen. Solche Denkschemata und Begriffe dann auf "die Zeit", welche nunmal für diese Welt ein bedeutende Rolle spielt, anzuwenden, sobald es um "Unsterblichkeit-Erlangen" ,"Erleuchtungerlangen" wollen geht ist ebenso unpäßlich und unanangebracht; wer dann noch mein "Tieropfer" oder auch Menschenopfer unterschiedlichster Un-Arten, inklusive Vergewaltigungsritualen, Zwangsinitiationen udgl  einer Göttin Kali oder Durga darbieten zu sollen, der verhöhnt jene Göttinnen - wenn es jene nunmal geben sollte - einfach nur. Denkt man jedoch in falschen Begriffswelten wie "Vernichterin der Zeit" wird man dann allzuleicht auch anderweitig geistig-sprachlich fehlgeleitet, was dann in absurden Handlungsweisen resultiert bzw all zu leicht resultieren kann.

Also wieso sollte man jene Täuschungsproblematiken ausklammern  müssen - nur weil irgendwelche Fanatiker aus Kirchen- oder auch Psychiatrie-Kreisen odgl systematisches Nicht-verstehenwollen an den tag legen bzw legten und man sich doch mit diesen Themen auch vernünftig bzw zumindest unmissverständlich genug befassen kann?


3) Vyasa:

Vyasa verfaßte va auch die Vedanta-Sutren und die Brahmasutras, wozu es jeweils mindestens eine Übersetzung in die deutsche Sprache gibt. In den Brahmasutras geht es um die Möglichkeit "Brahman" überhaupt erkennen zu können. Vedanta ist eines der 6 Systeme klassischer indischer Philosophie. Zu diesen beiden Werken gibt es Übersetzungen ins  Deutsche.

Seine Qualifiziertheit zur Verfassung des großen Epos Mahabharata ergibt sich ua daraus, daß er einen Kommentar zu Samkya und auch zu Patanjali's Yoga Sutren verfaßte:


ISBN 978-0-282-45556-9
ISBN (In Leinen gebunden?) 978-0-331-48441-0





 Die Bhagavad Gita ist das Kernstück des  Mahabharata (....das auszugsweise vor ca 1 Jahr im Volkstheater München auf der kleinen Bühne zur Aufführung kam...) und wurde vielfach auch ins Deutsche, sowie in zahlreiche andere Sprachen übersetzt. In der Bhagavad Gita geht es sowohl um Samkya als auch um Yoga; Krishna, der Arjuna belehrt, erklärt Ihm seinen Lehre aus der Sichtweise des Samkya und dann auch vom Standpunkt des Yoga. Samkya und Yoga sind weitere Systeme der 6 Systeme klassischer indischer Philosophie:

Dr Franz Hartmann übersetzte es im Nicht-Gedicht-Stil ca 1905 und  in poetischer Form übertrug Er es nach Edwin Arnolds Sanskrit-Übersetzung ins Deutsche, siehe etwa vierte Auflage 1924, Theosophisches Verlagshaus Leipzig.

Die Übersetzung von Richard Garbe, erstmals 1905 bei Haessel in Leipzig erschienen, Nachdruck folgend der 2.Auflage von 1921, Anaconda-Verlag GmbH Köln,ISBN 978-3-7306-0416-8 wäre da auch noch zu erwähnen.

Aber auch von Shri Aurobindo gibt es eine Übersetzung und auch eine Übersetzung dazu ins Deutsche. 

Ebenso verfaßten viele andere Autoren Übersetzungen und Kommentare dazu.

Von  Mr. Mahesh Prasad Varma - alias Maharishi Mahesh Yogi - gibt es eine - nunmal -unvollständige Übersetzung mit ausführlichem (eigenwilligen und teils, wie ich meine, irreführenden) Kommentar, wobei die Übersetzung zu nahezu 100% aus wortgetreuen Übernahmen aus anderen Übersetzungen, lt. Mr. Mahesh's eigener Schilderungen, besteht; nur in Ausnahmefällen fertigte Vernon Kaatz eine Übersetzung an, welche Mr. Mahesh - besser - zu passen schien; Mr. Mahesh's Sanksrit-Kenntnisse hätten dafür - so schilderte Er es mal - nie&nimmer ausgereicht. (Näheres siehe zB meine Rezension bei amazon.de)

Die Bhagavad Gita - und damit auch ein gewisser Zeitbereich für die Lebensdaten des Herrn Vyasa - wird von Herrn Russel Re Manning (...) auf ca 250 v. Chr. datiert. Siehe S. 35 in "Religion in 30 Sekunden, Russel Re Manning, Librero-Verlag, erschienen im englischen Irginal 2011, ISBN 978-90-8998-822-5. Herr Manning doziert an der Thelogischen Fakultät der University of Cambridge und ist Mitglied des dortigen St. Edmund's College.

Prof. John Bowker datiert in seinem Buch "Religionen der Welt" (..Coventgarden, ISBN 978-3-8310-9057-0, englische Orginalausgabe erschien erstmals 1997...) auf Seite 32 das Epos "Mahabharata" und damit die "Bhagvad Gita", welche ein Teil desselben ist, auf zwischen 300 v. Chr. und 400 n. Chr.

Es gibt auch eine deutschsprachigen Ausgabe der Bhagavad Gita von Richard Garbe (er übersetzte es aus dem Sanskrit), Ausgabe von 1921, nachgedruckt bei Anaconda 2016, ISBN 978-3-7306-0416-8. Richard Garbe schrieb 1894 auch einen Text zur Samkya-Philosophie:

 


 

ISBN

978-1-391-58838-4

ISBN (in Leinen gebunden?)

978-1-396-60230-6




In Herrn Garbe's Ausgabe zur Bhagavad-Gita wird die Entstehung der Bhagavad Gita in mehrere Perioden eingeteilt, wobei die erste Periode - zu der eine Art Ur-Bhagavad-Gita gehört, welche nur ca die Hälfte Anzahl an Versen umfaßt habe - von einer unbestimmten Zeit bis 300 v. Chr. gerechnet wird:

Seite 29: " Wenn man auch nicht durchaus nötig hat, die >>Gottesliebe<< schon der ursprünglichen Bhagavata-Religion zuzuschreiben, so war doch der Glaube der Vasudeva-Verehrer jedenfalls von diesem Gefühl schon erfüllt, lange bevor die Bhagavad-Gita gedichtet worden ist; denn eine neue Idee wird anders verkündigt als die bhakti in der Bhagavad Gita, wo diese Empfindung auf Schritt und Tritt wie etwas Selbstverständliches gefordert wird." ...

Seite 29: "In diese erste Periode, die ich von dem unbestimmte Anfang bis gegen 300 v. Chr. rechnen möchte, fallen wahrscheinlich alle bisher in diesem Kapitel behandelten religionsgeschichtlichen Vorgänge, d.h. kurz zusammengefaßt: Die Begründung des populären Monotheismus durch Krishna-Vasudeva, die philosophische Verbrämung mit Samkya-Yoga, die Vergöttlichung des Stifters und, wie ich glaube, auch schon die Vertiefung des religiösen Gefühls durch die Forderung der bhakti.

Seite 29: Die zweite Periode wird charakterisiert durch die Brahmanisierung der Bhagavata Religion und die Identifizierung Krishnas mit Vishnu. Schon die große Volkstümlichkeit der Sagen und Legenden, von denen die Gestalt Krishnas umwoben war, muß die Aufmerksamkeit der Brahmanen erregt haben;"....

Seite 31: "Ich glaube, die zweite Periode der Bhagavata-Religion von 300 v. Chr. bis etwa zum Anfang unserer Zeitrechnung ansetzen zu dürfen. Jedenfalls gehört die ursprüngliche Bhagavadgita - ohne mit dieser Bemerkung zunächst etwas über ihre Datierung aussagen zu wollen in diese Periode deshalb hinein, weil in ihr Krishna noch nicht mit dem Brahman identifiziert, aber mehrfach als Vishnu bezeichnet wird (von den 3 Stellen       X. 21, XI. 24, 30 gehören die beiden letzten schon dem alten Gedicht an) und weil       IV.  6-8 eine Anspielung auf die Avtar-Theorie enthält.

Seite 31: Die dritte Periode der Bhagvata-Religion, für die ich die Zeit vom Beginn unserer Zeitrechnung bis zur Mitte des 11.Jahrhunderts annehmen möchte, ist gekennzeichnet durch die Identifizierung Krishna-Vishnus mit dem Brahman; es bleiben aber trotz der Vedantisierung des Krishnaismus die alten Samkya-Yoga-Elemente bestehen. In der Frühzeit dieser Periode ist die Umarbeitung der Bhgavadgita vorgenommen worden."

Seite 34: "Fassen wir nun die ursprüngliche, noch nicht vedantisierte Gita ins Auge, wie ich sie aus der überlieferten Gestalt herauszuschälen versucht habe, so bedarf es zunächst kaum eines Hinweises darauf, daß sie den allgemein-indischen Glauben an die Seelenwanderung, an die nachwirkende Kraft des Werkes und an die Möglichkeit der Erlösung aus dem qualvollen Kreislauf des Lebens teilt."


Wenn nun aber Richard Garbe in seiner Einleitung eine Vedantisierung dieser "urprünglichen Bhagvadgita" erst in der dritte Periode sieht und für jenes philosophische System"Vedanta" aber Herrn Vyasa als Urheber gilt, lebte Herr Vyasa demzufolge am Anfang jener dritten Periode, also in etwa nach Beginn unserer Zeitrechnung und innerhalb der ersten paar Jahrhunderten danach.


Mr. Mahesh verlegt die historischen Ereignisse, welche der Bhagavad Gita zugrunde liegen in die Zeit um 3000 v. Chr. und das Auftreten sowie die Lehren der Bhagvad Gita in jene Zeit und setzt es mindestens 2000 bis 2500 Jahre vor Budhas an. Nachdem Shankara einen Kommentar zur Bhagavad Gita schrieb, muß die Bhagavad Gita daher vorher geschrieben worden sein. Nachdem die Lebensdaten von Shankara als bekannt gelten, muß Herr Vyasa gelebt haben bevor Shankara seinen Kommentar zur Bhagavad Gita verfaßte. Auch muß Vyasa nach Patanjali gelebt haben, da er ja zu dessen Yogasutren einen Kommentar verfaßte.


Eine künstlerische Präsentation der Bhagvad Gita findet man zB bei Dr. med. Mohani Heitel; In ihrem E-Book singt sie 72 ausgewählte Verse und liest sie dann auch in deutscher Übersetzung (alles mit sanfter Gitarrenbegeleitung); es gibt aber auch eine rein-gesangliche Darbietung auf Sanskrit von ihr.

siehe zB.: 

Bhagavat Gita - Microsoft Store

https://www.microsoft.com/de-de/store/music/album/dr-mohani-heitel/bhagavat-gita/8d6kgx0h8z7c
Bhagavat Gita Dr. Mohani Heitel. 2016 • 15 Musiktitel • Hörbuch / Hörspiel • Hörbuch • Smirti Music. Album kaufen 14,99 € Mit ...

Amazon.com: Kapitel 3: Bhagavat Gita: Dr. Mohani Heitel ...

https://www.amazon.com/Kapitel-3-Bhagavat-Gita/dp/B01C7FXJJO
Buy Kapitel 3: Bhagavat Gita: Read Digital Music Reviews - Amazon.com

Hörprobe: https://www.amazon.de/Bhagavat-Gita/dp/B01CRA65RC/ref=sr_1_3?ie=UTF8&qid=1513166413&sr=8-3&keywords=mohani+heitel


Links vom 13.12.2017


deutschsprachige Literatur im Zusammenhang mit Vyasa, der auch Badarayana genannt wird:

"Bhagavad Gita", Nachdruck der Ausgabe von 1907, ISBN 3-8262-0812-9, Dr. Franz Hartmann

 



"Bhagavad Gita, Das Lied von der Göttlichkeit oder die Lehre vom göttlichen Sein", von Dr. Franz Hartmann, dritte und vierte Auflage, Leipzig, Max Altmann, 1919

"Die Bhagavad Gita", in poetischer Form nach Edwin Arnolds Sanskrit-Übersetzung ins Deutsche übertragen von Franz Hartmann M.D., vierte Auflage, 1924, theosophisches Verlagshaus Leipzig

"Bhagavad Gita", 2.Auflage von 1921, Anaconda-Verlag GmbH Köln, ISBN 978-3-7306-0416-8

 


Bhagavad Gita, übersetzt von von Dr. Franz Lorinser in "Gedichtform",1869,

ISBN 978-0-366-11388-0
ISBN (in Leinen gebunden?) 978-0-366-15077-9

Dr.Lorinser meint, daß christliche Einflüsse die Bhagavad Gita wesentlich geprägt hätten. Dr. Paul Deußen widerspricht dem, sich auch unmittelbar auf Dr. Lorinser beziehend, zB in seiner Vorrede zu seiner Übersetzung des Vedanta. Dennoch ist die Übersetzung von Dr. Lorinser in Gedichtform durchaus sehr gut zu lesen und wenn man zB jenen "Schlüsselvers" aus der Sicht von Hr. Mahesh Prasad Varma aus Kapitel II mal heranzieht, so ist die Übersetzung von Dr. Lorinser kaum verschieden von jener des Hrn. Mahesh Prasad Varma:

Bhagavad Gita, der vollständige Text ,mit dem Kommentar  Shankaras , Knaur Esoterik,, München 1989, ISBN 3-426-26447-1.






Hier erst noch ein kleiner Vergleich der Übersetzungen anhand einer der "Zentralstellen" gemäß Mr. Mahesh

 Dr. Lorinser verfaßte:

 

 

 

 

 

 


Von Dr. Franz Hartmann, Ausgabe 1919, wurde das wie folgt übersetzt:


Bei Dr. Richard Garbe, Reprint der Ausgabe von 1921, heißt es dazu:



Bei Mr. Mahesh (genauer deutsche Übersetzung von 1971  seiner Übersetzung jener Verse) heißt es dazu so:


Übersetzung gemäß "Knaur Esoterik":





 "Brahmasutra", Badarayana, Übersetzung aus dem Sanskrit und Kommentar von Raphael, 1. Auflage 2008, ISBN 978-3-89901-141-8, Übersetzung Beate Schlepp, J.- Kamphausen-Verlag.  Titel der Orginalausgabe: Brahmasutra, 2005, Asram Vidya, Rom, ISBN 88-85405-54-1

Badarayana, 766 Seiten, Leipzig, F.A. Brockhaus 1887, "Sutras des Vedanta oder die Cariraka-Mimansa des Badarayana", zB Lesesaal der Stadt Bibliothek München am Gasteig.

"System des Vedanta nach den Brahma Sutras des Badarayana und dem Kommentare des Cankara über dieselbe", 1906, F.A. Brockhaus, Paul Deussen, 540 Seiten


"System des Vedanta nach den Brahma Sutras des Badarayana und dem Kommentare des Cankara über dieselbe", 1906, F.A. Brockhaus, Paul Deussen, 540 Seiten, CLASSIC REPRINT SERIES, Forgotten books, ISBN 978-1-332-35463-4, FP&c Lttd, Dalton House, 60 Windsor Avenue, London, SW 19 2RR.

Das Bemühen um korrektes Verstehen/Verstehenwollen, kommt auf Seite 235/236 zB zum Ausdruck:

 

 


Über die Begreifbarkeit der Vedantasutras heißt es bei Deußen, daß sowohl Vyasa ( wird auch Badarayana genannt)= als auch Shankara es so darstellten, daß es per Reflexion nicht wirkliich begreifbar sei. zwar wird der Reflexion andererseits ein Rolle zuerkannt (wenn alles Brahman ist, so auich die Reflexion und das Reflektieren und insofern steht Reflexion nicht im Widerspruch zu Brahman und der Lehre des Brahman; aber auf der Ebene des Reflektieren selbst bleibend geht es eben nicht; es erfordert jenes "Transzendieren", wie es Mr. Mahesh auszudrücken pflegte. Aber an dieser Stelle möchte ich Prof, Dr. Deußen in seinen Ausführungen zu Vedanta zu Wort kommen lassen; erst ein Auszug von Seite 103; Ausführlichers, dh Seite 95 bis Seite 103 dann in der Bildergalerie zum Durchblättern und lesen:

 

 

 

 



 

 

 

 

Das System des Vedanta, S 95..






Die Sutras des Vedanta oder die Cariraka-Mimansa des Badarayana nebst dem vollständigen Commentare des Cankara. Aus dem Sanskrit übersetzt. Leipzig, F.A. Brockhaus, 1887, derzeit (dh 12.August 2018) erhältlich als Reprint bei CLASSIC REPRINT SERIES, Forgotten books, FP&c Lttd, Dalton House,, 60 Windsor Avenue, London, SW 19 2RR, Die Lieferzeit beträgt derzeit allerdings ca 2 Monate.

ISBN 978-1-390-98573-3
ISBN (in Leinen gebundene Ausgabe?) 978-1-396-37603-0


 

 

 

 





Es sei nicht versäumt in diesem Zusammenhang ergänzen darauf hin zu weisen, daß diese Übersetzung des Vedanta inklusive des Kommentars von Shankara von Prof. Paul Deußen in Form der 1.Ausgabe, gemäß der Vorrede, bereits im Jahre  1887 erfolgte und daß es gemäß Seite X der Vorrede die erste vollständige Übertragung der Vedanta-Sutren inklusive des kompletten Kommentars von Shankara in eine europäische Sprache war.

- Man gewinnt da gleichzeitig einen interssanten Einblick in jene Zeit; erstaunlich, daß es damals bereits verfügbar war, wie es dann nach dem 2. Weltkrieg plötzlich im Zusammenhang mit Shri Yukteswar (die Hl. Wissenschaft, O.W. Barth Verlag) Paramahansa Yogananda (Autobiographie eines Yogi - aber auch Übersetzung der Bhagavad Gita u.a.), Shri Aurobindo, Maharishi Mahesh Yogi, Osho - der anscheinend nunmal ursprünglich wirklich Philosophieprofessor in Indien gewesen und, zumindest intellektueller, Kenner der gesamten Materie war - und Anderen zu einem  Thema für Viele wurde, nicht mehr unter den Tisch gekehrt werden konnte, aber dennoch systematisch gemäß "Bewußtem Nicht-Verstehen-Wollen" udgl diffamiert und verfolgt wurde bis die "Verfolger" schließlich stolz so in etwa verkündeten "es ist eigentlich heutzutage kein Thema mehr". Nun wurden die Grundlagen der "indischen Geisteswelt" abermals wiederentdeckt und in Form höchstseriöser Herangehensweise und Bemühungen betreffs "Gerechtwerdung" bei "forgottenbooks.com" - insbesondere auch als PDF-Dateien und somit papierlos - verfügbar gemacht. -

Dabei hatte Prof Deußen die Absicht dazu beizutragen, daß allen - deutschsprachigen - Philosophiestudenten die wichtigsten Werke der indischen Geisteswelt in zuverlässiger Form in Detsch vorliegen sollten, aufdaß sie nicht extra auch noch Sanskrit zu erlernen haben sollten. Was seiner Ansicht nach dabei vorrangig und unverzichtbar ins Deutsche übersetzt werden sollten, listete er auf Seite IX seiner Vorrede freundlicherweise auf; diese Seite erlaube ich mir hier zu zitieren:



Anhand dieses Zitats kann man ersehen, welche große Bedeutung Prof. Deußen den Vedanta-Sutren aber auch Shankara's Kommentar dazu beimaß/beimißt.

Erfreulicherweise gibt es Etliche, der von Prof. Deußen für wesentlich erachteten Übersetzungen ins Deutsche, tatsächlich.


Srimad Bhagavatam:

Auch dieses Werk wurde, zB gemäß https://wiki.yoga-vidya.de/Bhagavata_Purana, von Vyasa verfaßt. Eine Übersetzung ins Deutsche gibt es zB insbesondere durch das, offenbar große, Interesse des "Hare Kirshna"-Ordens an diesem Werk. Bei obiger Quelle findet man zB folgende Hinweise, die ich rein informationshalber erwähne:

Zitat aus: https://wiki.yoga-vidya.de/Bhagavata_Purana




Ein Zeitgenosse von Vyasa war - gemäß des Heftchens "Narada's Bhakti Sutras" (MAngalam-Verlag S. Schnag, ISBN 3-922-477-48-8, 1980/1995) der Weise Narada, der in der Chandogya Upanishad erwähnt wird; er war zu Sanatkumar gegangen, um von Ihm wahrhaft spirituelles Wissen zu erlangen.




4a) Narada:

Vorwort zu Narada's Bhakti-Sutras, MAngalam Verlag S. Schang, ISBN 3 - 922 477 - 48 - 8, 1980/95


 

 

 

 

Seite 4 und Ende des Vorworts zu "Narada's Bhakti Sutras"



In der Chandogya-Upanishad (folgende Zitate siehe zB.: Eknath Easwaran, Goldmann-Verlag, ISBN 978-3-442-21826-4 WG 2927), heißt es dazu:

 

 

 

 

aus: Eknath Easwaran, Goldmann-Verlag, ISBN 978-3-442-21826-4 WG 2927

 

 

 

 

Eknath Easwaran, Goldmann-Verlag, ISBN 978-3-442-21826-4 WG 2927, Seite 256





Es sei darauf hingewiesen, daß sowohl Herr Naradaals auch dessen Lehrmeister Sanatkumara in Shankara's "Narmada Ashtakam" Erwähnung fanden/finden; siehe untere "10) Swami Brahmanda Saraswati:" und dessen gesangliche Darbietung des Narmada Ashtakam sowie meine, dort zu fiindende, Übersetzung ins Deutsche:

"So wie Honigbienen um die Blumen kreisen, den Wohlgeruch der Blüten aufnehmend, um den Nektar aufzusaugen,
hielten sich große Weise wie Sanatkumara, Nachiketa, Kashapya, Atri und Narada entspannt und sich entspannend bei Dir auf;  sie besänftigten, beruhigten, erholten sich, indem sie sich bei Dir aufhielten.
Du spendest Glück für das Glücklichsein, Du trägst Glück bei zum Glücklichsein von Lord Sonne, dem Mond, Rantideva und Lord Indra.
Oh du großartiger Fluß Narmada ich verneige mich vor deinen Lotus-Füßen!"





4) Yajnavalkya:

Er unterwies König Janaka, siehe Brihad-Aranyaka-Upanishad, etwa Diderichs Gelbe Reihe, ISBN: 3-89631-426-2





5) Janaka:

Er war - nach seinem Vater Vyasa - der Lehrer von Shukadeva. Man sehe etwa Yogavasishta, Kapitel II, der Anfang der Unterweisung, [Die Geschichte von Suka], Seite 19-20; (,Die Lehren des Weisen Vasishta, Ansata-Verlag, ISBN3-7157-0112-9)




6) Shukadeva:

Shukadeva war der Sohn von von Vyasa; siehe auch Yogavasishta, Kapitel II, der Anfang der Unterweisung, [Die Geschichte von Suka], Seite 19-20; (,Die Lehren des Weisen Vasishta, Ansata-Verlag, ISBN3-7157-0112-9)

Bei Yogawiki, >> https://wiki.yoga-vidya.de/Shukadeva << (Link vom 3.7.2017) heißt es dazu ua:

>> Shukadeva war der Sohn des Weisen Vyasa (dem man die Zusammenstellung der Veden und Puranas zuschreibt) und der wichtigste Erzähler der Bhagavata Purana. Der größte Teil der Bhagavata Purana besteht darin, dass Shukadeva die Geschichte des sterbenden Königs Parikshit erzählt. Shukadeva wird als Sannyasin dargestellt, der der Welt entsagt hat, um Moksha (Befreiung) zu erreichen. Die meisten Erzählungen zeigen, dass er es erreicht hat. Er ist das fünfte und letzte Mitglied der Rishi Parampara des Advaita Gurus Parampara.<< ...

>>Das Mahabharata erzählt auch, wie Shukadeva von Vyasa zu König Janaka in die Lehre geschickt wurde. König Janaka galt als Jivanmukta, als lebendig Befreiter. Shukadeva fragte Janaka nach dem Weg zur Befreiung. <<.. 

(ad der Unterweisung von König Janaka durch Yajnavalkya gibt es eine Upanishade, den Brihad-Aranyaka-Upanishad, etwa Diderichs Gelbe Reihe, "Upanishaden",ISBN 3-89631-426-2)




7) Gaudapada:

Gaudapada hinterließ einen Kommentar zum Madukya Upanishad; Gaudapada war der Lehrer von Yogi Govinda, welcher wiederum der Lehrer von Shankara war. Jener Kommentar zum Mandukya Upanishad wird in englischer Sprache im Internet vielfach angeboten, ua:

Mandukya Upanishad With Gaudapada's Karika and Shankara's ...
www.amazon.in/Mandukya-Upanishad-Gaudapadas...Commenta...


Mandukya Upanishad: with Gaudapada’s Commentary

zB: https://books.google.de/books?id=9vXFcUYWgxsC&pg=PA5&dq=Mandukya+Upanishad:+with+Gaudapada+Commentary&hl=de&sa=X&ved=0ahUKEwi6lZbg5dnWAhWpKcAKHcc_CzgQ6AEIJjAA#v=onepage&q=Mandukya%20Upanishad%3A%20with%20Gaudapada%20Commentary&f=false Link geprüft am 5.10.2017

ISBN 978-81-88157-43-3


https://books.google.de/books?isbn=1537055712 - Diese Seite übersetzen
Charles Johnston - 2016 - ‎Religion
with Gaudapada's Commentary Charles Johnston. 17. ... See Sankaracharya's Bhashya (commentary) on the Mandukya Upanishad, which includes commentary on the Mandukya-Karika.


The Mandukya Upanishad with Gaudapada's Karika and Shankara's ...

https://www.wisdomlib.org/.../mandukya-upanishad-karika-bhas...


Diese Seite übersetzen
15.02.2016 - The Mandukya Karika by Gaudapada is a commentary on the Mandukya Upanishad. The school of philosophy this book attempts to expose is


Im Lüchow-Verlag erschien eine Übersetzung aus dem Italienischen: "Gaudapa, Mandukyakarika, Jenseits von Shivas Tanz, mit einem Kommentar von Raphael", ISBN 3-932761-05-7, 1.Auflage 2001, Aus dem Italienischen von Gruppo Kevala.

Quellenangabe für meine Übersetzung; ich übersetze die Upanishade mit, um den Kommentar von Gaudapa - um den es hier im Eigentlichen geht - in Beziehung zur Upanishade - zu welcher er als Kommentar von Gudapada verfaßt wurde - darzustellen:


Mandukya Upanishad with Gaudapada's Karika - Swami J
http://swamij.com/upanishad-mandukya-karika.htm
The Mandukya Upanishad is 12 verses on AUM Mantra. Gaudapada's Karika is commentary relating to those 12 verses.



Mandukya Upanishade mit
Gaudapada's Karika

übersetzt ins Englische von Swami Nikhilananda
(Upanishaden)

Der Mandukya Upanishad besteht aus 12 Versen über das Mantra AUM. Gaudapada's Karika ist ein Kommentar der in Beziehung steht zu diesen 12 Versen.



Mandukya Upanishade - Verses I - VI


I:  Hari Aum! AUM, das Wort, ist all dies, es ist das ganze Universum. Eine deutliche Erklärung dessen ist Folgendes: Alles was Vergangenheit, Gegenwart und Zukunft ist, ist in Wirklichkeit, AUM. Und was auch immer es sonst noch jenseits der 3-fachen Teilung der Zeit gibt - jenes ist in Wahrheit AUM.

II. All dies ist in Wirklichkeit, Brahman. Dieser Atman ist Brahman. Dieser sölbige Atman hat 4 Viertel.

III. Das erste Viertel wird Vaisvanara genannt; dessen Handlungsbereich ist der Wachzustand, der äußerer Objekte bewußt ist; der 7 Gliedmaßen hat, neunzehn Münder und welcher der Erfahrende der groben Objekte ist.

IV. Das zweite Viertel ist Taijasa, dessen Auswirkungsbereich der Traumzustand ist, welcher der inneren Objekte bewußt ist, der mit 7 Gliedern, desweiteren neunzehn Mündern ausgestattet ist und welcher der Erfahrende der subtilen Objekte ist.

V. Jenes ist der Zustand des Tiefschlafes, worin - schlafend seiend - man weder ihr Objekt begehrt noch irgendwelche Träume sieht, in dem alle Erfahrungen zusammenkommen,verschmelzen,münden; der wahrlich eine Masse Bewußtsein ist, das voll ist von Glückseeligkeit und eine Glückserfahrung hat; er ist die Tür, die zum Wissen über Träumen und Wachen führt.

VI. Er ist der Regent,der Herr von allen/allem. Er ist der Wissende von allem. Er ist die innere Kontrollinstanz. Er ist die Quelle von allen, da aus Ihm alle Wesen entspringen und in Ihm schließlich verschwinden.



Gaudapa's Karika (Kommentar von Gaudapa):


1) Viseva ist alldurchdringend, der Erfahrende äußerer Objekte. Taijasa ist der Erkennende innerer Objekte. Prajna ist eine Masse von Bewußtsein. So ist es ein Einziges das durch diese 3, mittels dieser 3 Zustände, gewußt wird.

2) Visva ist der, welcher durch das rechte Auge erkennt; Taijasa ist der, welcher  durch den Geist im Inneren erkennt; Prajna ist der Raum im Herzen. Deshalb wird der eine Atman im selben Körper als 3-fach erfahren.

3-4) Visva erfährt das Grobe; Taijasa erfährt das Subtile und Prajna erfährt das Glückseelige. Verstehe diese 3-Fachheit der Erfahrung. Die groben Objekte befriedigen Visva; die subtilen Objekte stellen Taijasa zufrieden und das Glückseelige läßt Prajna zufrieden sein. Kenne diese als die 3-Fachheit der Zufriedenheit und der Befriedigung, Befriedetheit.

5) Beschrieben wurden der Erfahrende und die Objekte der Erfahrung in Beziehung zu den 3 Zuständen. Jener/Jene/Jenzwi  der/die/zwi dies weiß/wissen geraten nicht in einen Zustand des Verhaftetseins in die Objekte, wenn sie sich derer erfreuen.

6) Zweifelsohne muß ein Zur-Existenzkommen sich ins Tätigsein aller positiven Wesen, welche existieren, einfügen. Prana manifestiert alle nicht lebewesen-seienden Objekte. Der Purusha manifestiert alle bewußten Wesen in deren vielfältigen Formen.

7) Einige derjenigen, die über den Vorgang der Schöpfung nachdenken/kontemplieren, betrachten ihn als die Manifestation der Mächte von Gott/den GöttInnen/Göttzwi; andere stellen sich die Schöpfung als etwas wie Träume und Illusionen vor.

8) Jene, die von der Wirklichkeit der manifestierten Objekte überzeugt sind, schreiben die Manifestation ausschließlich dem Willen Gottes zu; dahingegen betrachten jene, die betreffs der Zeit mutmaßen, die Zeit als den Schöpfer/die Schöpferin/dieSchöpfzwi der Dinge.

9) Einige sagen, daß das Manifestieren sowie die Manifestation die Absicht Gottes oder auch dessen Vergnügen ist; andere hingegen ordnen sie seiner/ihrer/ihrzwi Vielheit/dessen bzw derer Aufgeteiltheit zu. Aber es ist die eigentliche Natur des Glanzes,des Strahlens,der Herrlichkeit des Seins. Welcher Wunsch, welche Begierde, welche Art des Wünschens, welche Art des Begehrens ist/sind für jemand möglich, der/die/zwi das Erfülltsein aller Wünsche und Begierden ist?


Mandukya Upanishade Verse VII:

VII: Turiya ist nicht das was der inneren (subjektiven) Welt bewußt ist, noch ist es das was der äußeren (objektiven) Welt bewußt ist, noch ist es das was beider bewußt ist, noch ist es eine Masse Bewußtsein. Es ist nicht einfach Bewußtsein noch ist es Nichtbewußtsein. Es ist unwahrgenommen, nicht in Bezug zu etwas seiend, nicht umfassbar, nicht erreichbar im Bereich der Schlußfolgerung/des Schlußfolgerns, undenkbar und unbeschreibbar. Es ist die Essenz des Bewußtseins, die sich als das Selbst in den 3 Zuständen manifestiert, es ist das Aufhören aller Phänomene; es ist voll und ganz Friede, voll und ganz Glückseeligkeit und nicht-dual. Dies ist es was als das Vierte (Turiya) bekannt ist. Es ist Atman und dies hat verwirklicht  zu werden.


Gaudapa's Karika (Kommentar von Gaudapa):

10 Turiya, der unveränderliche Regent, Regler ist fähig alle Qualen, alles Elend, allen Jammer, alle Not zu beseitigen. Indem alle anderen Wesen, eigenständigen Seinsheiten,Einheiten unwirklich sind, wird der nicht-duale Turiya alleine als strahlend, voller Ganz und all-durchdringend gewußt.

11 Visva und Taijasa werden, von Ursache und Wirkung bedingt, eingeschränkt. Prajna ist ausschließlich von Ursache abhängig.

12 Prajna weiß überhaupt nichts von Selbst oder auch Nicht-Selbst, von Wahrheit oder auch Unwahrheit. Aber Turiya ist stets existent und nimmt alles wahr.

13 Das Nicht-Erkennen, Wahrnehmen von Dualität haben Prajna und Turiya gemeinsam.  Aber Prajna ist assoziiert,verbunden,verknüpft mit dem Tiefschlaf in der Form von Ursache und dieser Schlaf existiert in Turiya nicht.

14 Die ersten Beiden, Visva und Taijasa hängen mit Träumen bzw Schlaf zusammen; Prajna dabei mit Schlaf, welcher der Träume beraubt ist. Wissende von Brahman, Brahman-Kenner sind in Turiya frei,jenseits von Schlaf und Träumen.

15 Träumen ist die falsche Erkenntnis und Schlaf ist das Nicht-Erkennen von  Realität. Wenn das irrige, irrtümliche, falsche, unstete Wissen in diesen beiden "zerstört"/überwunden wurde, wird Turiya verwirklicht.

16 Wenn der/die/dös Jiva, (wie) schlafend unter dem Einfluß von anfangloser Maya, erwacht ist/erweckt wurde erkennt/verwirklicht er/sie/zwi sodann geburtlose, schlaffreie und nicht traumverhaftete/traumfreie Nicht-Dualität.

17 Wäre die phänomenale Welt wahr,wirklich,real, dann würde sie gewißlich verschwinden. Das Universum der Dualität, das wahrgenommen,erkannt wird ist pure Illusion (Maya); Nicht-Dualität alleine ist die Höchste Wirklichkeit/Realität.

18 Wenn sich irgend so wer wie ein/eine/dös Lehrer/~in/~zwi, illusionäre Gedanken wie das Gelehrte und die Schriften vorstellt, dann werden diese sich auflösen,verschwinden. Diese  Ideen sind zum Zwecke der Unterweisung. Dualität endet wenn die Realität gewußt wird.


Mandukya Upanishade - Verse VIII bis XI:

VIII Derselbe Atman der vorhin als ausgestattet mit 4 Vierteln erklärt/dargestellt wurde, wird aus dem Blickwinkel der Silbe AUM beschrieben. AUM, das ebenfalls in Teile zerteilt ist, wird vom Standpunkt der Buchstaben aus betrachtet. Die Viertel des Atman sind dieselben wie die Buchstaben von AUM und die Buchstaben sind dieselben wie die Viertel. Die Buchstaben lauten A, U und M.

IX: Vaisvanara Atman, dessen Sphäre der Aktivität, dessen Einflußbereich, Aktivitätsspäre der Wachzustand ist, ist A, der erste Buchstabe von AUM und zwar aufgrund seiner Alldurchdringendheit oder auch aufgrund dessen, daß er der Erste ist. Jemand, der das weiß, erlangt die Erfüllung aller Wünsche und wird der Erste unter den Großartigen, wird großartig.

X: Taijasa Atman, dessen Bereich der Akitvität der Traumzustand ist, ist U, der zweite Buchstabe von AUM und dies aufgrund seiner Überlegenheit oder auch seines Dazwischenseins. Jemand der das weiß, erlangt überlegenes Wissen, erlangt Gleichbehandeltwerden durch alle und findet in seiner Familie niemanden, der unwissend bzw ungebildet in Bezug auf Brahman wäre.

XI: Prajna Atman, dessen Spähre der Tiefschlaf ist, ist M, der dritte Buchstabe von AUM und das weil beide den richtigen Rahmen haben, im richtigen Verhältnis sind, dasselbe Versmaß haben und desweiteren weil in ihnen alle Eins werden. Wer das weiß ist fähig alles zu messen/einzuordnen und umfaßt/begreift alles in sich selber.


Gaudapa's Karika (Kommentar von Gaudapa):


19 Wenn es erwünscht ist, die Identität von Visva und des Buchstabens A zu beschreiben, ist die grundlegende Basis dafür per der Tatsache gegeben, daß jeder der Erste ist in seiner jeweiligen Spähre, Ein anderer Grund für diese Identität ist der alldurchdringende Charakter all dieser.

20 Die klare Grundlage für das Realisieren von Taijasa als seiend von derselben Natur wie der Buchstabe A ist das gemeinsame Merkmal/Charakteristikum von Überlegenheit/Übergeordnetheit. Ein anderer, simpler Grund für diese Art von Identität liegt darin, in der Mitte zu sein.

21 Der unbestreitbare Grund für die Identität von Prajna und M  ist die charakteristische Gemeinsamkeit, daß beide das Maß, der Maßsstab sind. Der andere Grund für die solchige Identität ist ein anderes gemeimsames Charakteristikum, nämlich daß beide den Zustand  des Zusammenführens, der Verschmelzung repräsentieren, symbolisieren, darstellen.

22 Jemand, der mit Gewißheit die Gleichartigkeit der drei Zustände und der Buchstaben von AUM auf der Basis derer gemeimsamer Charakteristika weiß, wird von allen Wesen geehrt und bewundert und ist außerdem ein großartiger Weiser.

23 Durch Meditation in Bezug auf A erlangt ein Suchender/eine Suchende/einz Suchzwi Visva; durch Meditation bezüglich U wird Taijasa erlangt; und Meditation betreffs M führt zu Prajna. Meditation über das "Tonlose" führt zu keiner Errungenschaft.


Mandukya Upanishade - Verse XII:

XII: Das Vierte (Turiya) ist ungeteilt, ohne Einzelteile und beziehungslos,ohne Beziehungen,ohne Bezüge; Es ist das Aufhören der Phänomene; Es ist einfach nur gut und nicht-dual. Dieses AUM ist in aller Wahrheit wirklich Atman. Jemand der das weiß vereinigt sein Selbst mit Atman - jawohl, jemand der dieses weiß.


Hier endet die  Madukya Upanishade.



Gaudapa's Karika (Kommentar von Gaudapa):


24 AUM sollte Viertel für Viertel gewußt werden. Es gibt keinen Zweifel darüber, daß die Viertel dasselbe sind wie die Buchstaben. Hat man AUM Viertel um Viertel verstanden, sollte man nicht an irgendwas anderes denken.

25 Die geistigen Aktivitäten, der Geist sollte auf AUM hin gesammelt werden. AUM ist das angstfreie Brahman. Jemand der für immer in AUM aufgegangen ist/für immer seinen Platz in AUM gefunden hat, kennt keine Angst welcher Art auch immer.

26 AUM ist wahrlich das untere,geringere Brahman. Es wird aber auch behauptet, daß es das höhere Brahman sei. AUM ist ohne Anfang und einzigartig. Es gibt nichts außerhalb davon. Es ist nicht verbunden mit irgendeinem Effekt und ist unwandelbar, unvergänglich, unabänderlich.

27 AUM ist tatsächlich der Anfang, die Mitte und das Ende von Allem. Jemand, der AUM als unwandelbar, unabänderlich, unveränderlich verwirklicht, erkannt hat, ist zur höchsten, letztendlichen Wirklichkeit gelangt.

28 Man sollte wissen, daß AUM der/die/dös Ishwara ist, der/die/zwi jederzeit in den Herzen aller ist. Die ruhige, stille Seele, die über AUM als all-durchdringend kontempliert,sich aufrichtig,unvoreingenommen und wahrheitsorientiert damit befaßt, ist deswegen jedenfalls nicht bekümmert oder auch depressiv, keinesfalls bekümmert und auch nicht depressiv.

29 Jemand der AUM - welches tonlos und mit unendlicher Tonfülle, mit unendlich vielen Tönen ausgestattet ist, welches nur gut ist und die Negation von Dualität - weiß, ist wirklich eine/ein/ön Weise/er/~zwi und niemand sonst ist weise.


Kapitel II von Gaudapa's Karika - Vaitathya Prakarana                                          (Das Kapitel über Illusion,Täuschung)

1. Harih Aum. Jemand der weise ist spricht von Unwirklichkeit all der Wesen, der Seinsheiten die in Träumen wahrgenommen werden, weil sie im Körper lokalisiert sind und der Raum darin beengt ist.

2. Der Träumer/die Träumerin/dös Träumzwi kann, aufgrund der Kürze der damit verbundenen Zeit, nicht aus dem Körper hinausgelangen und die Objekte der Träume damit nicht sehen. Außerdem findet er/sie/zwi, nach dem Aufwachen, die Plätze, welche er/sie/zwi in den Träumen sah, nicht.

3. Das Schrifttum besagt, auf der Basis von Rationalität, daß die Streitwägen usw, die in den Träumen wahrgenommen werden, der Nicht-Existenz zu zuordnen seien.

4. Die unterschiedlichen Objekte, die im beengten Raum der Träume gesehen,wahrgenommen worden sind bzw gesehen, wahrgenommen werden, sind unwirklich  da sie empfunden werden. Aus demselben Grund - dh weil sie gesehen, wahrgenommen werden - sind Objekte, die im Wachzustand zB empfunden werden, ebenfalls unwirklich. Dieselbe Bedingung des  blosen Empfindens, dh die Tatsache des wahrgenommen werdens, existiert sowohl im Wachzustand als auch beim Träumen. Der einzige Unterschied liegt in der Begrenzung des Raums, der mit Traumobjekten verbunden ist.

5. Geistvolle Menschen sprechen von der Gleichartigkeit der Wach-und Traumzustände aufgrund der Ähnlichkeit bzw Parallelität der Objekte, die in beiden Zuständen, auf der bereits erwähnten Grundlage, empfunden werden.

6. Falls eine Sache sowohl bei seinem Beginnen/anfänglich als auch seinem Enden/ schlußendlich nicht-existent ist, kann es in der Gegenwart nicht existent sein, es kann in der Gegenwart dann auch nichts anderes als nicht-existent sein. Die Objekte, die wir sehen sind wirklich wie Illusionen; dennoch werden sie für real gehalten.

7. Die Nützlichkeit von Objekten der Wach-Erfahrungen finden in Traumzuständen ihren Widerspruch; deshalb sind sie gewiß unwirklich. Insofern sind beide Erfahrungen, obgleich sie einen Anfang und ein Ende haben unwirklich.

8. Die Objekte, die von Träumenden wahrgenommen werden und im Wachzustand üblicherweise nicht vorkommen schulden/verdanken ihre Existenz den sonderbaren Umständen der Wahrnehmenden, dh dem Funktionieren des Geistes, dem Funktionieren der gedanklichen Aktivitäten während der Zeit in welcher die gedanklichen Aktivitäten sind als wäre er wie eines jener Wesen, die in einem Himmel wohnen. Träumende, die den Traumbedingungen verhaftet sind, nehmen jene Objekte wahr. Das ist so wie wenn jemand, der hier/irgendwo genau Bescheid weiß, sich von einem Platz an einen anderen begibt und die besonderen, mitunter merkwürdigen,eigentümlichen Objekte sieht, die zu jenen Plätzen gehören.

9-10 Das, was im  Rahmen der geistigen Prozesse des Träumens vorgestellt wird, gilt als illusionär und das was vom Geist außerhalb wahrgenommen wird gilt als wirklich, real. Aber wahrheitsgemäß sind beide als unwirklich erkennbar,wißbar und als solches bekannt. Insofern gilt analog für den Wachzustand, daß das was innerhalb der geistigen Aktivitäten vorgestellt wird, illusionär ist und daß das, was vom Geist als außerhalb wahrgenommen wird, als wirklich gilt; aber beide sollten, auf der Basis rationaler Grundlegung, Überlegungen, für unwirklich gehalten werden.

11 Falls sowohl die Objekte die im Wachzustand als auch die Objekte die im Traumzustand wahrgenommen werden, illusionär sind, so stellt sich die Frage, wer denn alle diese Objekte wahrnimmt und wer sie sich wiederum vorstellt.

12 Es ist der selbst-leuchtende Atman, der, aufgrund der Macht seiner eigenen Maya, in sich selber all diese Objekte, welche das Subjekt innerhalb und außerhalb erfährt, durch sich selber vorstellt. Atman allein ist der Wahrnehmende und Erkennende von Objekten. Dies ist die Entscheidung zu der Vedanta gelangt, dies ist des Vedanta Entscheidung.

13 Der Lord (Atman) stellt sich, mit nach außen gerichteten geistigen Aktivitäten unterschiedliche Objekte in verschiedenen Formen, seien sie dauerhaft (wie zB die Erde) oder aber auch vergänglich (wie zB ein Blitz), vor und zwar Objekte, die bereits in seinem Geist in der Form von vasanas oder auch Wünschen vorhanden sind. Wiederum wendet Er auch seinen Geist nach innen und stellt sich so verschiedene Ideen vor, es kommen ihm/ihr/zwi so verschiedene Ideen.

14 Sowohl jene, die intern solange wahrgenommen werden als der Gedanke daran währt als auch jene, die außerhalb wahrgenommen werden und in Beziehung stehen zu zwei Zeitpunkten, sind allesamt nichts anderes als Objekte der Vorstellung, der Fantasie. Es gibt keinen Grund, keine Notwendigkeit zwischen beiden zu unterscheiden.

15 Sowohl jene, die innerhalb der geistigen, gedanklichen Aktivitäten als subjektive Ideen existieren und als unmanifest bekannt sind als auch jene, die als außerhalb in manifester Form existierend wahrgenommen werden, sind nichts anderes als Objekte von Vorstellungskraft, von Fantasie. Ihr Unterschied liegt lediglich im Unterschied der Organe mit deren Hilfe sie wahrgenommen werden.

16 Vor allem, insbesondere, vorderst wird der Jiva wahrgenommen, das verkörperte Individum und dann werden die unterschiedlichen Einheiten - sowohl Äußere so wie Töne, Formen als auch Innere so wie die Pranas, Sinnesorgane, usw - , die gesehen oder auch erkannt werden, wahrgenommen. So wie jemanden's Wissen ist, so ist auch jemanden's Gedächtnis.

17 So wie ein in Dunkelheit herumliegendes Seil, über dessen Natur man im Unklaren gelassen wird, als Schlange oder auch als Linie in Wasser vorgestellt wird, so wird Atman auf unterschiedliche Art und Weise wahrgenommen.

18 Sobald  die wahre Natur des Seils klargelegt ist, verschwinden alle Missverstände in bezug darauf und es erwächst die Überzeugtheit, daß es sich um nichts anderes als ein Seil handelt.  Ebenso wird die wahre Natur von Atman bestimmt; ebenso ist die Wahrheit über Atman bestimm-, ermittel- und entscheidbar.

19 Atman wird vorgestellt, angesehen als Prana und andere zahllose Ideen. All dies ist aufgrund von MAYA - welche zum glänzenden, strahlenden, leuchtenden Atman gehört -  wodurch es dann so zu sein scheint, als machte man sich selber was vor.

20 Jene, die mit Prana vertraut sind, beschreiben Atman als Prana; jene, die mit den Elementen vertraut sind, beschreiben Atman als die Elemente; jene, die mit den gunas vertraut sind, beschreiben Atman als die gunas; jene, die mit den tattvas vertraut sind, beschreiben Atman als tattvas.

21 Jene, die mit den padas vertraut sind, bezeichnen Atman als padas; jene die mit den Objekten vertraut sind, bezeichnen Atman als Objekte; jene, die mit den lokas vertraut sind, bezeichnen Atman als lokas; jene, die mit den Göttern/Göttinen/Göttzwi/Gott vertraut sind, bezeichnen Atman als Götter/Göttinen/Göttzwi/Gott.

22 Jene, die mit den Veden vertraut sind, beschreiben Atman als die Veden; jene, die mit den Opfern vertraut sind, beschreiben Atman als Opfer; jene, die mit dem/der/zwi Erfreuenden vertraut sind, beschreiben Atman als dem/der/zwi Erfreuenden; und jene, die mit den Objekten der Freude vertraut sind, bezeichnen Atman als die Objekte der Freude.

23 Wissende des Subtilen, nennen Atman das Subtile und Wissende des Groben, nennen Atman das Grobe. Jene, die mit der persönlichen Gottheit vertraut sind, bezeichnen Atman als persönliche Gottheit und jene, die mit der Leere vertraut sind, nennen Atman schlichtweg Leere.

24 Jene, die Zeit kennen, bezeichnen Atman als Zeit und jene, die Raum kennen, bezeichnen Atman als Raum. Jene, die versiert sind in der Kunst des engagierten Diskutierens bezeichnen Atman als das Streitthema oder auch Diskussionsthema und jene, die die Welten kennen, bezeichnen Atman als die Welten.

25 Diejenigen, die den Geist/die geistigen Vorgänge kennen, nennen Atman den Geist; die Wissenden von buddhi, bezeichnen Atman als buddhi. Die Kenner von chitta bezeichnen Atman als chitta; die Wissenden um  Rechtschaffenheit und Unrecht bezeichnen Atman als den Bereich von Rechtschaffenheit und Unrecht.

26 Einige sagen, Atman bestehe aus 25 kosmischen Prinzipien; andere reden von 26 Prinzipien; wieder andere behaupten es wären 31 Prinzipien; dann gibt es noch die ganz die Anderen, die ihn als etwas beschreiben/darstellen, was aus unendlich vielen Prinzipien bestehe.

27 Jene, die sich darauf verstehen andere zufrieden zu stellen, nennen Atman das Zufriedenstellen; andere die mit den Ashrams vertraut sind, bezeichnen Atman als Ashrams. Die Grammatiker nennen den Atman maskulines, feminines und neutrales Geschlecht; und noch Andere, bezeichnen ihn als Höheres Brahman und als Niederes Brahman.

28 Die Kenner der Schöpfung bezeichnen Atman als Schöpfung; die Wissenden um die Auflösung bezeichnen Atman als Auflösung; die Wissenden um das Erhalten, bezeichnen Atman als das Erhalten. Wahr ist, daß alle diese Ideen stets im Atman sich vorgestellt werden.

29 AnhängerInnen/SchülerInnen erfassen/begreifen nur jene Idee, die Ihm/ihr/zwi von seinem/seiner/seinz Lehrperson präsentiert wird. Atman nimmt die Form dessen an, was gelehrt wird und schützt so die Anhängenden/Lernenden. Vertieft seiend in jene Idee, wird von den Lernenden/Anhängenden Atman verwirklicht/erkannt.

30 Atman, der zwar von all diesen Ideen nicht losgetrennt ist, erscheint so als wäre Er losgetrennt. Jemand, der dies der Wahrheit entsprechend wirklich weiß, kann ohne irgendwelche Furcht die Bedeutuung der Veden wiedergeben, darlegen.

31 So wie Träume, Illusionen und Luftschlösser gesehen und betrachtet werden, so wird das faß-,greif-,fühl-,spürbare, reale Universum von den Weisen gesehen und betrachtet, die Vedanta richtig, gut, im Sinne des Verfassers verstanden haben.

32 Es gibt weder Auflösung noch Erschaffung, niemanden in Gebundenheit und niemanden, der sich in Disziplinen übt. Es gibt niemanden der nach Erlösung strebt und niemand, der befreit wäre. Dies ist die volle Wahrheit.

33 Atman stellt man sich als die unwirklichen Objekte, die als nicht existierend wahrgenommen werden, vor und ebenso gut als nicht-dualen Atman. Deshalb ist Nicht-Dualität Glückseligkeit.

34 Die Verschiedenheit im Universum existiert nicht als eine mit Atman identische Einheit,Existenz; sie existiert auch nicht durch sich selber. Weder ist sie getrennt von Brahman noch ist sie nicht-separat. Dies ist die Festellung eines Weisen.

35 Weise sind frei von Voreingenommenheit, Angst und Zorn; sie sind gut bewandert  in den Veden, haben Atman realisiert als frei von allen Phantastereien, frei von der Illusion der Verschiedenheit und als nicht-dual.

36 Folglich gilt: Atman als solches kennend, richte man seine Aufmerksamkeit auf Nicht-Dualität. Nachdem man die Nicht-Dualität verwirklicht/wahrheitsgemäß erkannt hat, benehme man sich in der Welt wie neutral, frei-bleibend - und insofern träge - wie ein Edelgas.

37 Der erleuchtete Sannyasin rühmt nicht irgendwelche Gottheiten, braucht nicht irgendwelche "Überlegenen" zu grüßen und hat es ebensowenig nötig Riten auszuführen, um irgendwelche Ahnen zu besänftigen. Sowohl den Körper als auch Atman betrachtet so jemand als seine Wohnung, sein Zuhause; er bleibt mit dem zufrieden, was sich Ihm nunmal als Möglichkeiten bietet.

38 Indem Er die Wahrheit bezüglich sowohl dessen erlangte was Innen exisiert als auch dem was außen existiert, wird so jemand eines mit der Wirklichkeit, er frohlockt, jubelt über die Wirklichkeit und weicht niemals von der Wirklichkeit ab, entfernt sich niemals von ihr.



Kapitel III von Gaudapa's Karika -Advaita Prakarana                                              (Das Kapitel über die Nicht-Dualität)


1  Der/die/zwi Jiva, der/die/zwi sich in hingebungsvolle Verehrungen begeben hat, in hingebungsvollen Verehrungen seine Zuflucht genommen hat, dauert im manifesten Brahman fort, verharrt, verweilt, lebt, wohnt in ihm. Er/sie/zwi denkt, daß bevor die Schöpfung war alles dieselbe Natur geburtloser Realität hatte. Deshalb sagt man, daß er/sie/zwi einen beschränkten Intellekt hat.

2 Deshalb werde ich nun das Brahman, welches ungeboren, stets dasselbe und frei von Engheit/Begrenztheit ist, beschreiben. Davon ausgehend, kann man verstehen, daß Brahman in Wirklichkeit sich nicht in Geburt begibt und zwar auch nicht im geringsten Maße und dies obgleich es es den Anschein hat, daß es überall manfest sei.

3 Atman, der wie Akasa (unendlicher Raum) ist, sei in Form der Jivas manifest geworden, heißt es; dies mag in Analogie zu den Räumen gesehen werden, die in Töpfen, Behältern eingeschlossen sind. Die Körper, so heißt es, seien auch aus dem Atman heraus manifestiert worden, seien auch Manifestationen des Atman und zwar so als wie Töpfe und dergleichen aus Akasa geschaffen sind. Betreffs der Manifestation von Atman ist dies eine Illustration.

4 So wie bei der Zerstörung eines Topfes udgl der Raum, der darin eingeschlossen war, mit dem großen, großartigen Akasa verschmilzt, sich wieder vereint, so vereinen sich die Jivas mit Atman.

5 So wie derselbe Schmutz, Rauch , usw, der den eingeschlossenen Akasa eines speziellen Topfes verschmutzt, nicht die anderen Räume, die in anderen Töpfen eingeschlossen sind, verschmutzt, so beeinflussen das Glück, Elend etc des einen Jivas nicht andere Jivas.

6  Obgleich die Vielfalt an Formen, Funktionen und Namen der Akasas, die mit verschiedenen Sammelbehältern verbunden ist, eingestanden wird, folgt daraus keinesfalls irgendeine wirkliche Differenzierung, Aufteilung des Akasa selbst. Die Schlußfolgerung bzgl der Jivas ist analog.

7 So wie der Raum, der in einem Topf eingeschlossen ist, weder eine Auswirkung noch ein Teil des wirklichen Akasas ist, so ist Jiva weder eine Folge noch ein Teil von Atman.

8 Kinder betrachten Akasa als etwas, das aus so was wie erdenem Schmutz besteht/gemacht wurde und evtl beschmutzt ist ; analog betrachten unwissende Menschen den Atman als ähnlich gemacht aus irdischem, erdenem Körper und mehr oder auch weniger verschmutzt, von Krankheitserregern, die wiederum aus Erde letztendlich gemacht seien, befallen sind, usw.

9 Atman verhält sich, was seine Geburt und seinen Tod,  sein Gehen und Kommen - dh Wiedergeburt - und seinem Leben,Wohnen in unterschiedlichen Körpern anbelangt, nicht anders als wie Akasa.

10 Alle Ansammlungen werden von Atman's Maya, als wie bei einem Traum, hervorgebracht. Man kann kein rationales Argument als Begründung derer Realität  finden,angeben - weder bei Gleichartigen noch bei solchen wo irgendwelche einen irgendwelchen anderen übergeordnet sind.

11 Das höchste, letztendliche, absolute SELBST ist das Selbst der 5 Hüllen, sowie das Physikalische und das Vitale, welche im Taittiriya Upanishad beschrieben sind. Dass das Absolute, Höchste, Letztendliche wie Akasa ist, wurde bereits dargestellt, erklärt.

12 Derselbe Akasa wohnt,lebt sowohl in der Erde als auch im Magen; analog wohnt,lebt dasselbe Brahman in den Paaren, welche in der Madhu-Brahmana beschrieben sind.

13 Die Identität von Jiva und Atman wird angemessen löblich dargelegt indem man auf deren Nicht-Dualität hinweist, diese aufzeigt. Deshalb ist ausschließlich Nicht-Dualität frei von Irrtum, frei von Fehlern.

14 Die Getrenntheit von Jiva und Atman, die in den früheren Abschnitten der Upanishaden, die sich mit der Schöpfung befassen, erklärt,dargelegt wird, ist bildlich, symbolisch, metaphorisch, weil diese Teile lediglich das aussagen, nur das darlegen was in der Zukunft passieren werde. Diese Getrenntheit kann nicht die wirkliche Bedeutung jener Text-Passagen sein.

15 Die Aussagen der Schriften betreffs der Schöpfung, welche die Beispiele von Erde, Eisen und Funken gebrauchen, haben den Zweck die Klarheit des Geistes zu fördern. Vielfältigkeit und Vieldeutigkeit existieren in Wirklichkeit auf keinerlei Art und Weise .

16 Es gibt die 3 Stufen des Lebens, die mit dem 3-fach-geteilten Verständnis der Menschen in Zusammenhang stehen: Untergeordnet,Unterlegen, minderwertig; mittelmäßig, zweitklassig; überlegen, höhergestellt, erlesen, vorgesetzt. Gewisse Schriften, haben solches sich Einfügen, entsprechende Vorschriften, Regeln zum Zwecke des Vorteils für die Unerleuchteten, aus Mitleid gelehrt.

17 Die Dualisten, die sich fest an ihre Schlußfolgerungen klammern, binden, widersprechen einander. Die Nicht-Dualisten finden keine Konfliktpunkte in Bezug auf jene.

18 Ab dann, wenn bzw sobald Nicht-Dualität  letztendliche, absolute, höchste Realität ist, wird Dualität als deren Auswirkung, Folge bezeichnet, erkannt. Dualisten sehen Dualität sowohl im Absoluten als auch im Relativen. Aus diesem Grund verursacht die Position des Nicht-Dualismus keinen Konfilkt bzgl der Position des Dualismus.

19 Der ungeborene Atman wird mannigfaltig durch Maya und auf keine andere Art und Weise. Denn wenn die Vielfältigkeit real wäre, würden die Unsterblichen sterblich werden.

20 Die RechthaberInnen,StreiterInnen bestehen, darauf dass das ungeborene Wesen, das ungeborene, eigenständige Etwas geboren werde. Aber kann man denn allen Ernstes erwarten, daß ein eigenständiges Etwas, das geburtlos und unsterblich ist sterblich geworden sein sollte?

21 Das Unsterbliche kann ebenso wenig sterblich werden als das Sterbliche unsterblich werden kann. Das liegt daran, das es für nichts in der Welt möglich ist, seine eigene Natur zu verändern.

22 Wie kann denn jemand, der glaubt, daß ein eigenständiges, individuelles Wesen - das aufgrund seiner Natur unsterblich ist - sterblich wird,   aufrechterhalten, dass solches Unsterbliche, nachdem es Wandel unterlegen gewesen wäre, wieder seine Unveränderlichkeit zurückerlangen würde?

23 Aus einem Korn der einen oder anderen Art heraus geboren zu werden, mag real oder auch illusionär sein; beide Standpunkt finden sich gleichermaßen in Schriften. Aber ausschließlich jene Ansicht, die von Schriften Unterstützung findet und auch durch den Verstand bestätigt wird, kann akzeptiert werden und nunmal keine Andere.

24 Aus solcherlei schriftlichen Textpassagen wie "In Atman läßt sich keinerlei Vielfältigkeit ausmachen,entdecken" , oder auch " Indra (der höchstmöglich-denkbare Chef, der höchste, absolute, überlegene  Herr), nimmt durch Maya unterschiedliche Formen an", kennt man Atman, der - obwohl grundsätzlich ungeboren seiend und bleibend - so erscheint als wäre er vielfach geworden und das durch Maya.


25 Des Weiteren gilt, daß die Negierung der Schöpfung die Negierung von Geborenwerden zur Folge hat, impliziert. Die Kausalität von Brahman wird durch Feststellungen, Aussagen wie "Wer kann schon verursachen, daß es geboren wird?"  zurückgewiesen.

26 Aufgrund der Natur Atmans unfaßbar, unbegreifbar zu sein, weist die Schriftenstelle "Nicht dies, nicht dies" alle dualistischen Ideen bezüglich Atman zurück. Deshalb existiert nichts als der geburtslose Atman.

27 Bezüglich allem was jemals existiert gilt, daß dessen zur Geburt-Gelangen von Maya veranlaßt zu sein scheint; vom Standpunkt der wahren Wirklichkeit aus ist es aber nicht so. Wer aber denkt, daß dieses zur Geburt-Gelangen real sei besteht tatsächlich auch darauf, daß das was geboren wird auch abermals geboren werden wird.

28 Das Unwirkliche kann nicht geboren werden, weder wirklich noch durch Maya. Das ist so wie, daß der Sohn einer unfruchtbaren Frau weder wirklich noch durch Maya geboren werden kann.

29 So wie in Träumen der Geist, die geistigen Aktivitäten mittels Maya tätig ist/sind, dabei das Erscheinen, den "Auftritt" von Dualität präsentiert, so handelt der Geist auch im Wachzustand durch Maya, die Erscheinungsweisen von Maya präsentierend.

30 Zweifelsohne erscheint der Geist, der in Wirklichkeit nicht-dual ist, in Träumen so als wäre Er dual; analog kann kein Zweifel darüber bestehen, daß  im Wachzustand das was nicht-dual ist, d.h. Atman, als dual erscheint.

31 All die Vielfalt der Objekte, die das Bewegliche und Unbewegliche umfaßt, werden nur durch den Geist wahrgenommen, existieren in Wirklickeit nur im Geiste. Schließlich wird niemals Dualität wahrgenommen, wenn der Geist seine Aktivitäten einstellt.

32 Wenn der Geist, nachdem man das Wissen, wonach Atman und nur Atman wirklich ist, verwirklicht hat, die geistigen Aktivitäten infolge dessen frei von Einbildungen,Täuschung sind und der Geist daher frei von Verlangen nach Objekten ist, die er erkannte, hört er auf Geist zu sein.

33 Wissen (Jnana), welches ungeboren und nicht Fantasien gleicht, nicht Fantasien gleichenden Vorstellungen entspringt, wird von den Weisen als stets untrennbar vom Wißbaren beschrieben. Das unveränderliche, unwandelbare und geburtlose Brahman ist das Ziel des Wissenhabenwollens, des Wissensdurstes, des Wissens. Das Geburtlose wird vom Geburtlosen gewußt.

34 Man sollte das Verhalten des Geistes wissen, kennen, der unter  Kontrolle ist, da ausgestattet ist mit Unterscheidungsvermögen, Urteilskraft  und weil frei von Illusionen, nicht Täuschungen erliegend; man sollte die Art und Weise beherrschter geistiger Aktivität kennen, die auf klarem Unterscheidungsvermögen und Freiheit von Täuschung beruht. Der Zustand des Geistes im Tiefschlaf ist nicht solcherart sondern andersartig.

35 Der Geist ist im Tiefschlaf zurückgezogen wohingegen das nicht so ist, wenn der Geist unter Kontrolle ist. Der kontrollierte, beherrschte Geist ist in Wahrheit das furchtlose Brahman, dessen Licht der Allwissenheit alles durchdringt, alldurchdringend ist.

36 Brahman ist geburtlos, schlaflos, traumlos, namenlos, formlos. Es ist immer strahlend, glänzend und allwissend. Keine Pflicht, welcher Art auch immer, kann damit  in Zusammenhang gebracht werden, es ist nicht in Zugzwang odgl zu bringen, es kann nicht erzwungen werden.

37 Atman ist jenseits von allem das mit Worten ausgedrückbar ist und ist jenseits aller Handlungen des Geistes, jenseits aller geistiger Aktivitäten. Atman ist großartiger Friede, ewiges Strahlen/unvergänglicher Glanz und Samadhi; Atman ist regungslos und furchtlos.

38 Brahman ist frei von geistiger Aktivität und daher auch frei von allen Ideen des Akzeptierens oder auch Verzichtens, Aufgebens. Wenn Wissen im Atman gegründet, verankert ist, erlangt das Wissen Geburtlosigkeit und Dauerhaftigkeit, bleibt es gleicherweise, dh wird unveränderlich, dauerhaft.

39 Dieser Yoga, der nicht in Berührung zu irgendetwas steht, jenseits der Berührbarkeit ist, ist für Yogis im Allgemeinen schwer zu erlangen. Sie fürchten sich davor, weil sie Angst in dem sehen was in Wirklichkeit Furchtlosigkeit ist.

40 Yogis, die Nicht-Dualität nicht wissen, verlassen sich auf  Kontrollieren, Kontrolle, Beherrschung um Furchtlosgkeit, die Zerstörung des Elends, der Elendigkeit zu erlangen, um SELBST-Erkenntnis, wahrheitsgemäßes, unveränderbares Wissen über das SELBST und um unvergänglichen, unzerstörbaren, dauerhaften Frieden  zu erreichen, zu realisieren.

41 Der Geist muß in kontrollierte Verhältnisse, zum Kontrolliertsein, Beherrschtsein gebracht werden und dies mittels nicht bedrückendem, Niedergeschlagenheit mit sich bringendem, Depression verursachendem  Bemühen; es ist wie ein, Tropfen für Tropfen, Ent-leeren des Ozeans mittels eines Halms von Kusa-Gras.

42 Der Geist, der von Wünschen, Lust und Vergnügen verwirrt, zerstreut und besorgt ist, sollten mit geeigneten Mitteln unter Kontrolle gebracht werden; dasselbe gilt für den Geist, der den Vergnüglichkeiten des Nichtstuns, der Faulheit (laya) verhaftet ist. Der Zustand des Nichtstuns, der Faulheit ist ebenso schädlich wie der Zustand der Wünsche-,Lustverhaftetheit

43 Man ziehe den Geist - sich daran erinnerd, daß sie nur Elend, Trübsal, Nöte hervorbringen, mit sich bringt -  zurück von der Lust  am Wünschen. Man betrachte nicht all die geschaffenen, hervorgebrachten Gegenstände, indem man sich daran erinnert, daß all dies der ungeborene Atman ist.

44 Falls der Geist in Untätigkeit versinkt, erwecke man ihn von Laya; falls verwirrt,zerstreut,besorgt bringe man ihn zur Ruhe. Man verstehe die Natur des Geistes, wenn er den Samen von Sympathie,Parteiergreifung in sich trägt,hegt. Wenn der Geist jene Gleichförmigkeit, vollkommene Ausgeglichenheit, seine Identität erlangt hat, störe man ihn nicht erneut.

45 Der Yogi muß das Glück, das aus samadhi entspringt, nicht schmecken, probieren, auskosten; er sollte sich, durch die Übung des Unterscheidens, mittels unterscheidendem Denken, per kritischer Urteilskraft davon zurückziehen, davon ablösen. Falls sein Geist, nachdem Er Festigkeit erlangt hat, abermals äußere Objekte sucht, sollte Er dessen Einseins mit Atman ohne großartige Anstrengung erlangen.

46 Wenn der Geist nicht in Inaktivität, Faulheit versinkt und auch nicht durch Wünsche  in Verwirrung, Zerstreutheit, Besorgtheit gerät, wenn Er sozusagen unerschütterlich bleibt und auch nicht irgendwelche Erscheinungen, Gespenster hervorbringt, wird er wahrhaft Brahman.

47 Die allerhöchste Glückseligkeit weilt,liegt im SELBST. Sie ist Friede; sie ist Befreiung, Befreitheit; sie ist geburtslos und kann mit Worten nicht beschrieben werden. Sie wird, aufgrund dessen daß das sie eins ist mit dem geburtslosen SELBST, das allwissende Brahman genannt, das wahre Ziel des Wissens.

48 Kein Jiva erlangt jemals Existenz. Es gibt keine Ursache, welche ihn hervorbingen könnte. Die höchste, erhabendste, entscheidende Wahrheit ist, daß niemals irgendetwas geboren wurde.

Kapitel IV  von Gaudapa's Karika - Alatasanti Prakarana                                         (Das Kapitel über das Zur-Ruhebringen des Unruheverursachenden)


1 Ich anerkenne die Besten unter den Menschen, welche mittels Wissen - welches wie Akasa ist und nicht-verschieden ist vom Ziel des Wissens -  die Natur der Jivas (Dharmas), die ebenfalls wie Akasa sind,  erkannt haben.

2 Ich anerkenne den Yoga, der als asparsa bekannt ist - in den Schriften lehrreich dargestellt wird  - ,welcher für das Glück und Wohlergehen aller Lebewesen eintritt und frei ist von Kampf, Wettstreit und Widersprüchen.

3 Einige Gesprächsgegner vertreten die These wonach nur eine existente Wesenheit erneut existierend werden könne, wohingegen andere der TeilnehmerInnen an der Debatte, die stolz auf ihren Intellekt sind,  postulieren, daß nur eine nicht-existierende Wesenheit Existenz erlangen könne. Auf solche Weise, dementsprechend streiten sie miteinander.

4 Eine  existierende Wesenheit kann nicht erneut existent werden (Geburt); auch kann eine nicht-existente Wesenheit Existenz erlangen.  Indem sie so untereinander debatieren kommen sie zur nicht-dualistischen Sichtweise von Ajati (Nicht-Schöpfung).

5 Wir heißen Ajati (Nicht-Schöpfung), das so von ihnen als Ergebnis gefunden wurde, gut. Wir liegen nicht in Streit mit ihnen. Laßt uns nun unser Wissen - welches frei von allem Debatieren, diskutieren, jenseits aller Streitgespräche ist - über die elementare, entscheidende Realität hören.

6-8 Die Debatierenden behaupten, versichern, daß die ungeborene Wesenheit (Atman) geboren werde. Wie kann man erwarten, annehmen, daß eine geburtlose und unsterbliche Wesenheit sterblich geworden wäre? Das Unsterbliche kann nunmal nicht sterblich werden; ebensowenig kann das Sterbliche unsterblich werden. Schließlich ist es grundsätzlich unmöglich, daß ein Ding seine eigene Natur verändern könnte. Wie kann jemand, der glaubt, daß eine Wesenheit, die von Natur aus unsterblich ist, sterblich wird, den Standpunkt, die Ansicht aufrechterhalten, daß das Unsterbliche, nachdem es sich gewandelt gehabt hätte und Veränderlichkeit unterlegen gewesen wäre, seine unveränderliche, unwandelbare Natur  beibehalten habe?

9 Auf der Basis von Prakriti, oder auch - anders ausgedrückt - der Natur eines Dinges, versteht man betreffs Erwerb desselben, was der wesentliche, entscheidende Bestandteil des Dings, sein charakterisches Merkmal, seine unveräußerliche Natur, das was nicht dazu gehört, aber auch das was niemals aufhören wird es selber zu sein, von seiner Entstehung an sein werden, wenn man es erwirbt.

10 All die Jivas sind, aufgrund ihrer ureigenen Natur, frei von Greisenhaftigkeit und Tod. Aber sie sehen es so, daß sie sowohl Senilität, Alterschwäche als auch Tod unterworfen wären und, daß sie aufgrund der blosen Macht der Gedankenwelt so erscheinen als würden sie von ihrer wahren, ureigensten Natur abweichen.

11 Die Streitgesprächeteilnehmenden, welche den Standpunkt vertreten, daß die Ursache selbst die Wirkung sei, müssen auch verteidigen, daß die Ursache als die Wirkung entstehe, die Ursache zur Wirkung werde. Wenn es jedoch entstand, geboren wurde, einen Anfang hatte wie kann man es dann als geburtslos, ohne Anfang bezeichnen? Wenn es  Veränderungen unterworfen ist, wie kann es dann als ewig bezeichnet werden?

12 Falls es, wie man sagt, so wäre, daß die Auswirkung ununterschieden von der Ursache wäre, dann müßte auch die Auswirkung entstehungslos, ungeboren, anfangslos sein. Wie könnte, darüberhinaus, die Ursache ewig sein, wenn sie ununterschieden war/wäre von der Auswirkung, Wirkung, welche entstand, geboren wurde, folgte?

13 Es gibt keine Erklärung zur Untermauerung der Betrachtungsweise, wonach die Wirkung einer anfangslosen, geburtlosen Ursache entstamme. Nochmals, wenn man annimmt, daß die Wirkung, die Folge einer Ursache oder auch einer Geburt sei, die ihrerseits eine Ursache bzw eine Geburt habe, so führte das zu einem unendlichen, nicht endenden weiter Zurückgehenkönnen.

14 Wie können jene, die behaupten, daß die Wirkung  die Folge/die Ursache der Ursache sei und behaupten, daß die Ursache die Ursache der Wirkung sei, die Anfangslosigkeit von sowohl Ursache als auch Wirkung aufrechterhalten?

15 Jene, die sagen, daß die Wirkung die Ursache der Ursache und die Ursache die Ursache der Wirkung sei vertreten in der Tat den Standpunkt, wonach Schöpfung stattfände gemäß "Die Geburt des Vaters rührt vom Sohn her", "der Vater stamme vom Sohn ab".

16 Wenn Kausalität behauptet wird, dann muß auch eine Aussage zur Reihenfolge, in welcher Ursache und Wirkung aufeinander folgen, gemacht werden. Falls gesagt wird, daß sie gleichzeitig stattfänden, dann können sie - vergleichbar den zwei Hörnern eines  Tieres mit 2 Hörnern - nicht wechselseitig als Ursache und Wirkung in Beziehung stehen.

17 Die Ursache, die man darlegt, kann nicht zur Ursache gemacht, erklärt, ernannt werden, wenn sie von der Wirkung herrühre. Wie kann die Ursache, die ihrerseits nicht begründet ist, unerklärt blieb, Quelle/ Geburtsstätte der Wirkung sein?

18 Wenn denn die Ursache von der Wirkung hervorgerufen werden täte und andererseits die Wirkung wiederum der Ursache entspränge, so frägt man sich doch, welcher von den Beiden denn zuerst gewesen wäre und auf welchen der Beiden das Entspringen, die Geburt des Anderen beruhe.

19 Die Unfähigkeit auf die oben aufgeworfene Frage ein Antwort geben zu können, die Unwissenheit inbezug auf diese Angelegenheit und die Unmöglichkeit die Reihenfolge der Abfolge festlegen zu können, wenn man denn eine kausale Beziehungskette zuläßt/annimmt oder auch sich zu ihr bekennt führt Weise klarerweise zur Doktrin von Ajati - oder auch Nicht-Schöpfung (... Samsara...) - und läßt sie das unter allen Umständen auch aufrechterhalten, beibehalten.

20 Die Veranschaulichung per Same und Sprößling ist etwas, was noch des Beweises bedarf. Die Veranschaulichung, Darstellung, dh der mittlere Ausdruck, der seinerseits noch unbewiesen ist, kann nicht dafür benutzt werden, um die Bewiesenheit einer Behauptung, eines Theorems zu begründen.

21 Die Unwissenheit bezüglich Vorrangigkeit und Abfolge von Ursache und Wirkung beweist klar das Nichtsein von Schöpfung (Ajati). Falls der Jiva (Dharma) wirklich geboren worden wäre, wieso kann man dann seine vorherige Ursache nicht klarmachen?

22 Nichts, wasauchimmer, wird - weder aus sich selber heraus noch von einer anderen Wesenheit - geboren. Nichts wird jemals geschaffen, weder Seiendes noch Nicht-Seiendes noch sowohl Seines als auch Nicht-Seiendes.

23 Die Ursache kann nicht von einer anfangslosen Wirkung her kommen; auch kann die Wirkung nicht vom einer anfanglosen Ursache herkommen. Das was ohne Anfang ist, ist notwendigerweise ungeboren/frei von Geburt.

24 Subjektives Wissen muß ein Objekt als dessen Ursache haben; ansonsten wird Vielfalt nicht-existent. Außerdem gilt, daß aus der Erfahrung von Schmerz, die Existenz äußerer Objekte, die von den dualistischen Schriften anerkannt wird, zugegeben werden muß.

25 Die Dualisten bestehen - aus der Kraft der Vernunft heraus -  darauf, daß es eine Ursache für subjektives Wissen geben müsse. Aber vom Standpunkt der wahren Natur der Dinge aus kommen wir zur Aussage, wonach die sogenannte Ursache schließlich doch keine Ursache ist.

26 Der Geist steht nicht in Beziehung zu äußeren Objekten oder auch zu den Ideen, geistigen Gebilden, die als solche Objekte erscheinen. Dies liegt daran, daß Objekte nicht-existent sind und daß die Ideen, geistigen Gebilde, die als äußere Objekte erscheinen nichts anderes als geistige Aktivitäten, nicht-verschieden von Geist sind.

27 Der Geist tritt während keiner der drei Zeitperioden in die Kausalitäts-Beziehung ein. Wie kann er jemals einer Täuschung erliegen wo es für so eine Täuschung keine Ursache gibt?

28 Deshalb sind weder der Geist noch die Objekte, die vom Geist wahrgenommen werden jemals entstanden, geboren worden. Weil Brahman niemals was anderes ist als ungeboren, deshalb ist es Brahman auch nicht möglich etwas anderes zu sein als was es nunmal ist.

29 Die Ursache, nämlich Brahman, aufgrund derer der geburtslose Geist behauptet wird - und der gemäß der DualistInnen/~zwis davon geboren worden sei - ist selber ungeboren.

30 Wenn denn , was DualistInnen/~zwis bestreiten, die Welt ohne Anfang wäre, dann könnte sie nicht nicht-ewig sein. Moksha (Befreitheit) kann nicht ewig sein und zugleich einen Anfang haben. 

31-32 Falls eine Sache zum Anfang und am Ende nicht-existent  ist, ist es notwendigerweise auch in der Gegenwart nicht-existent. Die Objekte die wir sehen, sind wirklich wie Trugbilder, Illusionen, Fata-Morganas; trotzdem werden sie als wirklich betrachtet. Der Nützlichkeit der Objekte der Erfahrung im Wachzustand wird in den Träumen widersprochen; daher sind sie sicherlich unwirklich. Beide Erfahrungen haben einen Anfang und ein Ende.

33 Alle Wesenheiten, die in Träumen gesehen werden sind unwirklich, weil sie innerhalb des Körpers wahrgenommen werden. Wie ist es möglich, daß Dinge, Phänomene, die als existent wahrgenommen werden,  in Brahman - welches unteilbar und gleichartig ist - wirklich existent sind?

34 Es ist nicht vernünftig, den Standpunkt einzunehmen, daß ein träumendes Wesen  verrückt werden täte, aufgrund der Objekte, die von Ihm/ihr/zwi in den Träumen wahrgenommen werden, zu sehen wären; dies liegt an dem zeitlichen Zwiespalt, der zeitlichen Diskrepanz, die mit solch einer Reise verbunden ist. Außerdem findet er/sie/zwi sich, nach dem Aufwachen, nicht an den Plätzen wieder,  die er/sie/zwi in den Träumen sah.

35 Der/die/zwi Träumende erkennt, nach dem Aufwachen, die Illusionärheit der zB Konversationen, die er/sie/zwi mit FreundInnen, während des Träumens führte. Außerdem besitzt man/er/sie/zwi im Wachzustand nichts von alldem, das Er/was man während des Träumens erwarb.

36 Der Traum-Körper ist nicht-stofflich, weil der andere, dh der physikalische Körper - der davon verschieden ist - wahrgenommen wird. Analog zum Traumkörper sind alle Dinge, die vom Geist wahrgenommen werden, substanzlos/nicht-stofflich.

37 Wie wir inzwischen feststellen konnten ist die Erfahrung von Objekten in Träumen ähnlich der Erfahrung von Objekten im Wachzustand, wobei der Wachzustand als Ursache für die Traumerfahrung angesehen wird. Es liegt nur an jenen selber - welche Erfahrungen aus dem Wachzustand als die Ursache für die Erfahrungen des Traumzustands gelten lassen - , daß Erfahrungen im Wachzustand für wirklich gehalten werden können.

38 Von allen Wesenheiten wird gesagt, daß sie ungeboren seien, nachdem wir inzwischen zum Ergebnis kamnen, daß Geburt nicht als Tatsache eingeordnet werden kann. Es ist für das Unwirkliche/Nicht-Seiende vollkommen unmöglich vom Wirklichen/Seienden geboren zu werden, herzukommen.

39 Jemand der mit den Eindrücken nicht realer Objekte im Rahmen des Wachzustands angefüllt/ "überhäuft" wurde, sieht jene füllsamen Dinge auch in den Träumen. Aber im Wachzustand werden von jemand nicht die unwirklichen Objekte gesehen, die in Träumen gesehen wurden.

40 Das Nicht-Wirkliche, Nicht-Seiende kann nicht etwas anderes Nicht-Wirkliches, Nicht-Seiendes als seine Ursache haben; ebensowenig kann das Wirkliche/Seiende als seine Ursache das Nicht-Wirkliche/Nicht-Seiende haben. Wie völlig unmöglich ist es erst, daß das Wirkliche/Seiende die Ursache für das Nicht-Wirkliche/Nicht-Seiende sein könnte.

41 So wie eine Person, aufgrund von falschem Wisse,   im Wachzustand Objekte, deren Natur unerforschlich ist, handzuhaben scheint als wären sie wirklich, so nimmt so jemand auch im Traumzustand, aufgrund falschen Wissens, Objekte wahr, deren Existentsein nur im Traumzustand gegeben ist.

42 Weise Leute lehren Kausalität ausschließlich um deret willen, die in Angst vor Nicht-Schöpfung/Nicht-Erschaffenheit, - in Angst vor Schöpfung ist nur  "Samsara", in Angst/Sorge vor Schöpfung ist "nur" das Werk von Maya  - auf der Realität äußerer Objekte bestehen, weil sie solche Objekte wahrnehmen/wahrnähmen und außerdem weil sie sich an verschiedenerlei sozialer und religiöser Pflichten klammern.

43 Jene, welche Ajati (Nicht-Erschaffenheit, Nicht-Schöpfung) - weil sie Angst haben vor absoluter Nicht-Schöpfung/Nicht-Erschaffenheit und aufgrund ihrer Wahrnehmung äußerer Objekte - leugnen, werden nicht bewegt von dem Bösen, Schlimmen, das aus dem Glauben an die Schöpfung folgt. Dieses Böse, Schlimme, falls es irgendsowas gibt/geben sollte, ist nicht auschlaggebend, ohne Bedeutung für sie.

44 So wie ein Elephant, der durch Zauberkunst (von einem/einer/einzwi ZauberkünstlerIn), hervorgezaubert, erfunden wird, für wahr gehalten wird, weil er als existent wahrgenommen wird und weil er dem Verhalten wirklicher Elephanten entspricht, so werden auch externe Objekte für wahr gehalten, weil sie als existent wahrgenommen werden und weil man darauf reagieren kann.

45 Es ist ausschließlich Bewußtsein, Vijnana, das erscheint als sei es geboren/geschaffen, als bewege es sich oder auch als würde es zu  Materie bzw als nähme es materielle Formen an. Aber dieses Bewußtsein ist wirklich stets ungeboren/ohne Anfang und Ende/nicht Zeitlichkeit unterworfen, unveränderlich und frei von den Charakteristikas von Materiellheit; es ist ganz und gar, durch und durch, stets und für immer Friede und nicht-dual.

46 Insofern ist Geist niemals  abhängig von Geboenwordensein, von Geburt. Alle Wesen sind ebenfalls frei, unabhängig von Geburt, Gebordenwordensein. Jene, die dies wissen, verfallen nicht falschem Wissen, falschen Anschauungen.

47 So wie eine Linie, die von einem brennenden Holzscheit, das bewegt wird, (....So wie die Aufruhrlinie von umherziehenden UnruhestifterInnen...)  gerade, gekrümmt odgl zu sein scheint, so erscheint Bewußtsein, wenn es in "Bewegung"  kam, wenn es in Regung geriet, als wahrnehmende Person, das Wahrgenommene und dererlei.

48 So wie das brennende Holzscheit, wenn es nicht bewegt wird, nicht in Bewegung ist, frei von allen Scheinbarkeiten ist und unverändert bleibt, so ist es auch mit Bewußtsein, das wenn es nicht in Regung ist, frei von allen Erscheinungsweisen ist und nicht Veränderlichkeit unterworfen bleibt, unbeweglich, unveränderlich, stets dasselbe ist.

49 Wenn das Holzscheit bewegt wird, werden die Erscheinungen, Erscheinungsweisen, die davon herrühren, als von nichts anderem als dem brennenden Holzscheit kommend, als von/aus nichts anderem kommend wahrgenommen. Wenn es ruht, ist es nicht so, daß jene  Erscheinungen das brennende Feuerscheit irgendwie verlassen haben und wo anders hingegangen wären und sie ziehen/treten auch nicht in das brennende Feuerscheit ein.

50 Die Erscheinungen entspringen nicht dem brennenden Feuerscheit, weil deren Natur nicht von der Art einer Substanz ist. Das überträgt sich entsprechend auf Bewußtsein  und zwar wegen der Ähnlichkeit der Erscheinungsweisen.

51 - 52  Wenn Bewußtsein mit der Idee von Aktivität in Verbindung bebracht wird, so wie das in den Wach- und Traumzuständen der Fall ist, so ist es so, daß die Erscheinungen die aufzukommen, zu resultieren scheinen von nichts anderem her rühren. Wenn Bewußtsein inaktiv, nicht-aktiv ist, so wie im Tiefschlaf, dann verlassen die Erscheinungen weder das nicht-aktive Bewußtsein und gehen woanders hin, noch verschmelzen sie damit. Die Erscheinungen entspringen nicht Bewußtsein, sie entstehen nicht daraus, da deren Natur nicht jene einer Substanz ist. Sie sind unbegreifbar, unverständlich, da sie nicht der Beziehung von Ursache und Wirkung unterliegen

54 So werden also äußere Erscheinungen (Objekte) weder vom Geist verursacht noch wird der Geist davon verursacht. Von daher, auch ab dem Erlangthaben dieser Einsicht halten nachdenkliche, aufmerksame  Leute am Prinzip der absoluten Nicht-Erschaffenheit, Nicht-Schöpfung fest.

55 Solange jemand sich an den Glauben an Kausalität klammert, wird so jemand Ursachen und davon  hervorgerufene Folgen entdecken. Aber wenn diese Verliebe für, dieses Verhaftetsein in Kausalität sich abnutzt, indem Maße wie sie allmählich vergeht, wird Samasara zu etwas (aus) Nicht-Existentem.

56 Solange jemand sich an den Glauben an Kausalität klammert, wird sich Samasara weiterhin vor Ihm ausdehnen, entwickeln, ausbreiten. Aber wenn diese Verliebe für, dieses Verhaftetsein in Kausalität allmählich vergeht, indem Maße wie sie sich abnutzt, wird Samasara zu etwas (aus) Nicht-Existentem.

57 Das gesamte Universum ist erschaffen durch falsches Wissen; deshalb ist nichts in ihm ewig, von Dauer. Alles, einsseiend mit der grundlegenden, letztendlichen sowie uranfänglichen Realität ist wiederum ungeboren, unerschaffen; insofern gibt es sowas wie Zerstörung, Auflösung nicht.

58 Den Jivas wird Geburt zugeschrieben, zugestanden; aber so eine Geburt ist vom Standpunkt der Realität aus nicht möglich. Deren Geburt ist wie das Entstehen, die Erschaffung eines illusionären, nur aus Täuschung heraus existierenden Objekts. Jene Illusion, Täuschung samt dem einer Täuschung-Erlegensein hat keine eigene Existenz aus sich heraus, ist insofern nicht existent.

59 Ein illusionärer Sproß entsteht aus einem illusionärem Samen. Dieser illusionäre Sproß besteht weder für immer noch ist er zerstörbar. Das ist auch anwendbar auf die Jivas, es gilt analog auch für Jivas.

60 Die Begriffsbildungen wie "von Dauer", "unbeständig" können nicht auf die nicht-entstandenen, ungeborenen Jivas angewendet werden. Was mit Worten nicht beschrieben werden kann, kann nicht nach ewig, "von Dauer", unbeständig, nicht von Dauer unterschieden, eingeordnet werden.

61-62 So wie in Träumen der Geist mittels Maya tätig ist, die Tätigkeiten des Geistes vollständig in und durch Maya stattfindet und die Erscheinung von Dualität sich einstellt, so ist der Geist auch im Wachzustand aufgrund von Maya tätig und die Erscheinung von Dualität stellt sich ein. Zweifelsohne ist es so, daß der Geist, der in Wirklichkeit nicht-dual ist, in Träumen dual zu sein erscheint.  Analog gilt zweifelsohne, daß das was nicht-dual ist, dh Atman, im Wachzustand erscheint, als wäre es dual.

63 Der/die/zwi Träumende, der/die/zwi in seinen/ihren/aero Träumen in alle 10 Richtungen unherwandert, sieht die gesamte Vielfalt an Jivas, die aus Eiern, aus Feuchtigkeit udgl geboren werden, zur Welt kommen.

64 Diese Wesenheiten, welche Objekte des Geistes des/der/ero Träumenden sind, existieren nicht losgelöst, unabhängig, getrennt von dessen/deren/dero Geist.  Analog ist der Geist des/der/ero Träumenden nichts anders als ein Wahrnehmungsobjekt des/der/ero Träumendem/~n/~o.

65-66 Ein Mensch im Wachzustand, /der/die/ero in seinem/ihrem/aero Wachzustand in alle 10 Richtungen umherwandert, sieht die gesamte Vielfalt an Jivas, die aus Eiern, aus Feuchtigkeit udgl geboren werden, zur Welt kommen. Sie sind die Objekte des Geistes des Menschen im Wachzustand und existieren nicht losgelöst, unabhängig, getrennt davon. Analog ist der Geist eines Menschen im Wachzustand nichts anders als dessen Wahrnehmungsobjekt.

67 Sowohl der Geist als auch die Jivas sind jeweils Objekte der Wahrnehmung des jeweils Anderen, sind Objekte der wechselseitigen Wahrnehmung. Kann der Eine ohne dem Anderen existieren? Die Antwort weiser Menschen liegt in der Verneinung. Es gibt keine Evidenz, keine offenbare Wahrheit der Existenz des Einen ohne dem Anderen; sie werden nur wechseitig durch den jeweils Anderen wahrgenommen.

68-70 So wie der Traum-Jiva erscheint und verschwindet, so erscheinen und veschwinden auch diese Jivas, die im Wachzustand wahrgenommen werden. So wie der Jiva, der von einem Magier hervorgezaubert wird, "existent" wird und verschwindet, so erscheinen und verschwinden die Jivas, die im Wachzustand wahrgenommen werden, wieder. So wie ein künstlicher Jiva "existent" wird und wieder verschwindet, so erscheinen und verschwinden auch die Jivas, die im Wachzustand wahrgenommen werden, wieder.

71 Kein Jiva wird jemals existent.  Es gibt keine Ursache die ihn hervorbringen, zur Folge haben könnte. Die höchste, letztendliche Wahrheit ist, daß nichts jemals geboren wird.

72 Die Welt der Dualität, die als existent wahrgenommen und durch eine Subjekt-Objekt-Beziehung charakterisiert, dargestellt wird, ist wahrlich eine Bewegtheit des Geistes. Nochmals, der Geist hat, vom Standpunkt der Wirklichkeit aus betrachtet, keinen Kontakt mit irgendeinem Objekt. Daher wird einem versichert, daß er ewig und ungebunden, frei ist.

73 Das was aufgrund der Macht, Stärke falschen Wissens, auf der Basis von Einbildung, Täuschung, Getäuschtheit "existiert", existiert in Wirklichkeit nicht. Nochmals, das, dem nachgesagt wird, daß es existiere, weil es mittels der Stärke, Angesehenheit anderer Lehrinstitutionen, Gedankenkonstrukte, Lehrmeinungen gepflegt, propagiert, zum Modernen erhoben oder auch vorgeschoben wird, existiert in Wirklichkeit nicht.

74 Atman wird, vom Standpunkt falschen Wissens aus, das auf Einbildung, Täuschung, Getäuschtheit beruht , geburtslos (aja) genannt; In Wirklichkeit ist Atman nicht einmal geburtslos, ungeboren, anfangslos. Der ungeborene Atman wird, gemäß der Sichtweise falschen Wissens, das von anderen Lehrinstitutionen, Lehren gepflegt und gefördert wird, als geboren, entstanden bezeichnet.

75 Leute klammern sich fest an die Idee der Unwirklichkeit, dh Dualität. Aber so eine Dualität gibt es nicht. Jemand, der die Abwesenheit von Dualität verwirklicht hat, wird nicht wieder geboren, nicht wiedergeboren, ensteht nicht mehr, hat keinen Anfang mehr, weil dann kein Anlaß, keine Ursache für seine Geburt  bleibt.

76 Wenn der Geist keine übergeordnete, untergeordnete oder auch nebengeordnete           Ursache findet, wird er frei von Geburt. Wie kann es eine Wirkung ohne Ursache geben?

77 Die Geburtslosigkeit, Anfangslosigkeit des Geistes, welche frei ist von Manifestation und kausler Wechselbeziehung, ist absolut und dauerhaft, beständig, unerschütterlich. Dualität - dh der wahrnehmende Geist und dessen Objekte - ist nämlich lediglich eine Objektivierung, Vergenständlichung des Geistes.

78 Das Verwirklichen der Abwesenheit, des Nichtseins von Kausalität ist grundlegende, elementare Wahrheit und keine weitere Begründung für Geburt findend, erreicht man jene Verfassung, jene Seinsweise welche frei ist von Sorgen, Verlangen und Angst.

79 Aufgrund von Verknüpftheit mit bzw Gebundenheit an unwirkliche Objekte befaßt sich der Geist fortgesetzt mit solchen Objekten, verfolgt der Geist solche Objekte. Aber er kehrt zu seinem reinen bzw in seinen reinen Zustand zurück, sobald er Nicht-Verknüpftheit, Ungebundenheit, Nicht-Verhaftetsein, Nicht-Vorliebe - damit befaßt seiend deren Unwirklichkeit zu realisieren - erlangt.

80 Der Geist, der von aller Verknüpftheit, Gebundenheit, allem Verhaftetsein bzgl. sämtlicher äußerer Objekte befreit ist und von neuerlichen Objekten nicht zerstreut, gestört, abgelenkt wird, erlangt die Seinsweise der Unwandelbarkeit. Weise erkennen so einen Geist als eins mit Brahman, als Brahman seiend. Er ist nicht verfeinert, er ist geburtslos und nicht-dual.

81 Die geburtslose, traumlose und schlaflose Realität zeigt sich selber durch sich selber; dieses Dharma (Atman) ist nämlich, aufgrund seiner eigenen, bloßen Natur selbstleuchtend.

82 Der/das Lord (Atman) wird duch Verknüpfung, Verbindung mit bzw Verhaftung an bzw Sympathie, Unterstützung für die einzelnen Objekte leicht verborgen und es erfordert nicht selbstverständliche, großartige Bemühungen, Befleissigungen - dh da sind große, ver-flixte Schwiergkeiten, die dem entgegenstehen -, ihn zum Vorschein zu bringen.

83 Die Unwissenden mit ihrem kindischen Geist verdecken, verschleiern in Wirklichkeit Atman indem sie bzgl. Atman Eigenschaften wie "Existenz", "Nicht-Existenz", sowohl "Existenz als auch Nicht-Existenz"  und "totale Nicht-Existenz"  behaupten und diese Charakterisierungen aus Vorstellungen von Veränderung, Unbeweglichkeit, einer Kombination aus Veränderung und Unbeweglichkeit, oder auch absoluter Negation herleiten und diese in Zusammenhang bringen mit Atman.

84 Dies sind die vier Theorien betreffs Atman, die, wenn man jenen verhaftet ist/sich an sie bindet, Atman der eigenen Sicht für immer verborgen sein lassen. Wer den Lord als stets von jenen unberührt bleibend weiß, weiß tatsächlich alles.

85 Was bleibt für jemand noch zu wünschen übrig, der den Zustand eines Brahmin - einen Zustand völlig umfassenden Wissens und Nicht-Dualität, der ohne Anfang, Mitte und Ende ist - erlangt hat?

86 Die Bescheidenheit (vinaya) der Brahmins ist natürlich. Deren Ruhe, Gelassenheit (sama) ist ebenfalls natürlich. Desweiteren stellt sich die Kontrolliertheit, Beherrschtheit der Sinne (dama) auf natürliche Weise bei ihnen ein. Jemand, der Brahman verwirklicht hat, erlangt Frieden.

87 Vedanta erkennt klar den gewöhnlichen Wachzustand in welchem Dualität, bestehend aus Objekten und der Idee damit in Kontakt zu gelangen, eingeräumt wird. Es erkennt auch klar einen noch gewöhnlicheren Zustand, den Traumzustand, in welchem die Dualität - bestehend aus Objekten und der Idee, damit in Kontakt zu gelangen - erfahren wird, obwohl dererlei Objekte nicht existieren.

88 Weise Personen erkennen einen weiteren Zustand in welchem weder Objekte noch Ideen bezüglich derselben existieren. Dieser Zustand ist jenseits aller empirischer Erfahrungen. Sie beschreiben die drei wie folgt: Wissen, die Objekte des Wissens - dh die drei Zustände - und das absolut Wissbare, dh die elementare, grundlegende Realität.


89 Wissen und das 3-fach Wißende - eines nach dem Anderen -  verstanden habend, gelangt der Wissende mit Unterstüzung durch erhabenen, kritischen Intellekt selbst schon in diesem Leben und überall den Zustand umfassenden Wissens.

90  Man sollte schon von Anfang an mit vier Dingen vertraut sein; dies sind die Folgenden: Die Dinge, die zu vermeiden sind; das Ziel, das es zu erreichen gilt; die Diszipliertheiten, die zu kultivieren sind, die man sich zuzulegen hat und des Weiteren die Vorlieben, die man aufzugeben  hat, die Neigungen deren Anziehungskraft man zu überwinden hat,  gewisse Absichten, die man aufzugeben hat, Tendenzen, die man wirkungslos zu machen hat, denen man den Nährboden zu entziehen hat, Hinwendungen, die man zurückzuweisen hat.

91 Alle Atmans (Dharmas) muß man durch ihre eigentliche, wahre Natur als anfangslos und unverhaftet, unverknüpft wie Akasha wissen . Da gibt es nicht  - auch nicht auf die geringste Art und Weise und ebensowenig  irgendwann-wann-auch-immer  - den geringsten Spielraum.

92 Alle Jivas sind, aufgrund ihrer eigentlichen, wahren Natur,  von Anfang an erleuchtet, aufgeklärt. Es kann niemals irgendeinen Zweifel an ihrer Natur geben. Nur jemand,  der  -aufgrund dieses Wissendas, weil er das weiß, der dieses Wissen erlangt hat - ruht ohne nach weiterem Wissen zu verlangen, zu suchen, ist in der Lage Unsterblichkeit zu bekommen, zu gewinnen, zu erreichen.

93 Die Jivas sind, unmittelbar von Anfang an und aufgrund ihrer wahren, eigentlichen Natur, nichts als Friede, ungeboren und völlig frei. Sie sind charakterisiert von Gleichheit und Nicht-Zerteiltheit. Der ungeborene Atman ist stets gefestigt in, ruht in Gleichheit und Reinheit.

94 Jene, die stets im Bereich von Getrennheit, Zergliedertheit unterwegs sind,  können die Reinheit von Atman, Atman so wie und was Atman nunmal ist nicht erreichen, sich dessen nicht bewußt werden, nicht begreifen. Ihre Geister sind dem Zerteilen, Unterschied machen und  Auseinanderentwicklen zugeneigt und sie machen die Zergliedertheit des Atmans geltend. Deshalb werden sie als eng-stirnig und kleingeistig bezeichnet.

95 Nur jene dieser Welt werden höchste Weisheit gewinnen, die fest stehen in ihrem Überzeugtsein, ihrer inneren Gewißheit  von Gleichheit und Geburtslosigkeit des Atman. gewöhnliche Menschen begreifen deren Weg sowie Art und Weise nicht.

96 Wissentheit, welche die eigentliche Essenz der ungeborenen Jivas ist, wird selbst als ungeboren und  unverknüpft, beziehungslos bezeichnet. Dieses Wissen wird als unverknüpft, unverhaftet, nicht angefügt dargestellt, nachdem es mit keinem anderen Objekt verbunden oder auch verwandt ist.

97 Jenen unwissenden Menschen geht dessen ewiger unverknüpfter, unabhängiger Charakter verloren, die glauben, daß Atman von seiner eigentlichen Natur auch nur im Mindesten abweichen, sich abtrennen, abirren könnte. In jenem Falle ist die Zerstörung des Schleiers, der Maske kein Thema.

98 Alle Jivas sind stets frei von Gebundenheit und aufgrund ihrer eigene Natur rein. Sie sind schon vom Anfang an erleuchtet, aufgeklärt. Dennoch sagen die Weisen über die Jivas, daß sie fähig sind/seien die entscheidende, elementare Wahrheit zu wissen, zu kennen.

99 Das Wissen der weisen Wesen, welches völlig licht ist, ist niemals an irgendein Objekt gebunden. Sowohl  alle Jivas als auch alles Wissen sind stets nicht an Objekte gebunden. Dies ist nicht die Prüfung Buddhas.

100 Wenn wir das  - allerdings nicht unaufwendig, nicht gerade mir-nichts-dir-nichts  aber gründlich-umfassende, geburtslose, immer gleich bleibende, völlig lichte und von Vielheit freie  -  zu erlangende Wissen der grundlegenden, elementaren Wirklichkeit erworben, wahrheitsgemäß begriffen haben, heißen wir es so gut wir können willkomen, ziehen wir vor Ihm so gut wir können unseren Hut.

Aum. Friede! Friede! Friede!


Abschließende Grußworte vom Shankaracharya [in der Mandukya Upanishade]

Ich grüße Brahman, ich heiße Brahman willkommen, mir ist Brahman willkommen,    Brahman, das die Angst derer überwindet, auflöst, die bei Ihm Zuflucht suchen, bei         Brahman - das, aufgrund seiner magischen, täuschenden Kraft -  obwohl ungeboren seiend erscheint als wäre es mit Geburt verknüpft; Brahman, welches, obwohl unbeweglich erscheint als unterläge es Veränderlichkeit, sich zu bewegen scheint; und welches, obgleich nicht-dual, scheinbar viele Formen angenommen hat für jene, deren Sichtweise und Anschauung getäuscht wird durch die Wahrnehmung einer Vielzahl an Objekten und Eigenschaften.

Ich grüße Brahman, ich heiße Brahman willkommen, mir ist Brahman willkommen.      Ich drücke zu Füßen des Lehreres meines Lehrers  meine Ehrerbietung, Bewunderung und Verehrung für den Bewundernswertesten unter den Bewundernswerten aus, der   - aus reinem Mitleid für die Wesen heraus in den tiefen Ozean dieser Welt tauchte, in diese Welt, die von den schrecklichen, sozusagen, Haien unaufhörlicher Geburten und Todesfälle heimgesucht wird und der - , zum Nutzen, Vorteil für alle Wesen, diesen Nektar rettete, diesen Nektar, an den sogar von den Unsterblichen nur schwer heranzukommen ist, den er von den verborgensten, geheimsten Tiefen des Ozeans des Vedas aus rettete, sicherte, in dem er sie mit seiner Meßlatte des erleuchteten Weisheitszustandes durcharbeitete.

Ich drücke meine, aus meinem ganzen Wesen kommende, Bewunderung für diese der Tugendhaftigkeit dienenden Füße, für die Tugendhaftigkeit  -  welche die Ketten der Geburten und Wiedergeburten lösten -  meines eigenen großartigen Lehrers aus, der durch das Licht seiner erleuchteten Weisheit die Täuschung beseitigte/überwand, die meinen Geist umfing, einhüllte, vernebelte; für diese der Tugendhaftigkeit dienenden Füße, für die Tugendhaftigkeit meines eigenen großartigen Lehrers, der für immer meinem Erscheinen und Verschwinden in diesem schrecklichen Ozean unzähliger Geburten und unzähligem Sterben ein Ende bereitete; meinem großartigen Lehrer, der auch alle Anderen befähigt, zu seinen Füßen Zuflucht zu nehmen und allzeitwahres, niemals und unter keinen Umständen falsch-werdendes Wissen über die Schriften, den Frieden sowie den Zustand vollkommener Nicht-Zerstreutheit, Nicht-Abgespaltenheit, Nicht-Verlorenheit in Vielfältigkeiten aller Arten zu erwerben, zu erlangen.


Anmerkung des Übersetztes zu Hrn. Gaudapada's Vers 9 zu Mandukya-Upanishade I-VI:

Herr Echnaton, damals Pharao von Ägypten, der Begründer/"Erfinder" des Ein-Gott-Glaubens, nannte das Strahlen, den Glanz der Sonne "Aton"; darin sah Er das Göttliche; nicht in der Sonne sah Er Gott, sondern im Strahlen, im Glanz des Seins der Sonne erblickte Er Gott. (Siehe 50 Klassiker, Religionen, Peter Köhler, Gerstenberg-Verlag, ISBN 978-3-8369-2617-1, Seite 18: "Gewiß ist Jahwe nicht Aton, aber dass Echnaton die sichtbare Sonnenscheibe als Erscheinung einer in Wahrheit unsichtbaren Kraft verehrte,die als >>innere Glut des Atons<<, als ewige lebensspendende Kraft, der eigentliche Adrressat des Gebets war, deutet auf eine spirituelle Tradaitionslinie, die zum unsichtbaren Gott der Israeliten führt." bzw auf Seite 14/15 ..."- er nahm die Sonnenscheibe als das eine sichtbare Zeichen der nur scheinbar verschiedenen Sonnengottheiten und erhob Aton zum obersten und schließlich zum einzigen Gott" und auf Seite 15:"Ganz unvorbereitet kam das nicht. Schon Echnaton Vaters Amenhotep III hatte einen Sonnentempel errichtet und den Beinamen >>leuchtende Sonnenscheibe<< geführt. Auf Seite 19 schließlich noch, in der Ruprik 'Auf den Punkt gebracht': "Der einzige Gott soll fortan Aton sein, die Sonne, oder genauer: die von ihr ausgehende unsichtbare Kraft."


Anmerkung des Übersetzters zu Gaudapada's Kaurika Kapitel II, Vers 5:                   Siehe René Descartes, "Betrachtungen über die Grundlagen der Philosophie", ISBN 987-3-86820-327-1, NIKOL-Verlag:                                                                              

Seite 30: "Alles nämlich,was ich bis heute für das Allerwahrste hingenommen habe, empfing ich unmittelbar oder mittelbar von den Sinnen; diese aber habe ich bisweilen auf Täuschungen ertappt, und es ist eine Klugheitsregel, niemals denen volles Vertrauen zu schenken, die uns auch nur ein einziges mal getäuscht haben".....                                 

Auf Seite 31 findet man: "Bin ich nicht ein Mensch, der nachts zu schlafen pflegt und dann alles das und oft noch viel Unglaublicheres im Traum erlebt, wie jene im Wachen? Wie oft aber erst glaube ich nachts im Traum ganz Gewöhnliches zu erleben; ich glaube hier zu sein, den Rock anzuhaben und am Ofen zu sitzen - und dabei liege ich entkleidet im Bett!   Jetzt aber schaue ich sicherlich mit ganz wachen Augen auf dieses Papier. Dieses Haupt, das ich bewege, ist nicht vom Schlaf befangen. Mit Überlegung und Bewußtsein strecke ich diese Hand aus und habe Empfindungen dabei. So deutlich würde ich nichts im Schlafe erleben!   Ja, aber erinnere ich mich denn nicht, daß ich auch schon von ähnlichen Gedanken in Träumen getäuscht worden bin? Während ich aufmerksamer hierüber nachdenke, wird mir ganz klar, daß ich nie durch sichere Merkmale den Schlaf  vom Wachen unterscheiden kann, und dies macht mich so stutzig, daß ich gerade dadurch fast in der Meinung bestärkt werde, daß ich schlafe....


Anmerkungen des Übersetzers zu "Kapitel IV  von Gaudapa's Karika - Alatasanti Prakarana (Das Kapitel über das Zur-Ruhebringen des Unruheverursachenden)":

Vers 30:

Man vergleiche dazu zB die Ausführungen in Kapitel III, Verse 18, 19 und 20.

Vers 33:

Die "Weiße Frau" - siehe religiöser Taoismus - gilt als eine der 8 Unsterblichen im religiösen Taoismus und würde hier evtl. widersprechen, wenn es sie denn geben sollte; sie war, so heißt es - zB im Buch von John Bowker, ISBN:978-3-8310-9057-0, "Religionen der Welt" -  Asketin und kam nicht so recht voran; da erschien Ihr im Traum ein heiliges, vollkommenes Geistwesen und führte sie fortan und schließlich/allmählich habe sie die Unsterblichkeit "erlangt" und erstaunliche Fähigkeiten obendrein; auch "prophetische Träume", welche - zB sowohl vom Alten als auch Neuen Testament - als wirklich vorkommende Phänomene anerkannt werden, scheinen dem zu widersprechen, was Herr Gaudapada hier als Argument vorbringt. Insofern sollte man hier schreiben    :... Alle Wesenheiten, die in Träumen gesehen werden sind zweifelsohne unwirklich, sofern nicht jemand eine Existenz außerhalb seines Körpers, körperunabhängig  hat, auf der Basis wovon Er von "irgendwelchen höher gestellten, erleuchteten, guten Wesen" belehrbar ist/wäre. Die Dualisten, wie zB in den Vesen 17-20 des Kapitels III des Kommentars dargestellt wird, gehen nunmal davon aus, daß das anfangs-und endlose Brahman  zu dem Jiva - mit Anfang und Ende - werde und dieser Jiva ein im Körper Wohnender wäre - vgl Karika Kapitel II, Vers 1, Kapitel III, Vers 9 und Kapitel III Vers 12 -....) Im Brandhorst Museum in München war einmal eine Darstellung des Themas der "Weißen Frau" zu sehen und zwar mit Mitteln der Film-Kunst auf vielen Bildschirmen mit künstlerischer Zeitversetzung, sodaß es am anderen Bildschirm in räumlicher Entfernung weiterging, was auf dem einen Bildschirm gerade endete, wohingegen es auf dem ersteren Bildschirm mit etwas anderem wieder anfing. Wiederholt ging es um Ertrinkende, die von der "weißen Frau" auf wunderbare Weise gerettet wurden.

Vers 34:

Auch Tiere träumen; so gibt es Dokus, wonach zB Hunde während eines seitlich liegenden Schlafens, plötzlich anfingen mit den Beinen zu rennen und gleichzeitig immer wieder nach etwas zu schnappen, was für die Beobachtenden aus der "realen" Welt des "Wachens", gar nicht existent war...

Vers 61-62:

(Anm. des Übersetzers: Auch René Descartes wies in seinen Überlegungen explizit daraufhin, daß der Geist unteilbar sei. - Siehe René Descartes, Betrachtungen über die Grundlagen der Philosophie, NIKOL, ISBN 978-3-86820-327-1. Auf  Seite 24 heißt es: "..Dieser Schluß wird in der sechsten Betrachtung gezogen und wird daselbst noch dadurch bestätigt, daß wir alle Körper als teilbar, den Geist dagegen oder die menschliche Seele nur als unteilbar auffassen. In der Tat können wir ja von keinem Geist eine Mitte vorstellen, wie wir es bei jedem noch so kleinen Körper können"......)

Anmerkung des Übersetzters zu "Abschließende Grußworte vom Shankaracharya [in der Mandukya Upanishade]":  Mit Shankaracharya kann hier  eigentlich nur Shankara, der bisweilen auch als der "1. Shankaracharya" bezeichnet wird, selber gemeint sein. Es war schließlich Yogi Govinda der Lehrer von Shankara und der Lehrer von Yogi Govinda war wiederum Gaudapada.



Anm. des Übersetzers:

0)

Fortsetzung folgt

1) Professor Eknath Easwaran erwähnt in seiner Ausgabe der Upanishaden               (ISBN-Nummer jenes Buches: ISBN 978-3-442-21826-4 WG 2927; die zitierte Stelle findet sich auf Seite 105, in seinen Anmerkungen zur Kena-Upanishade) jene Theorie, wonach "vedische Mantren" keine Bedeutung haben ("anartha mantra"). Die sachlich-abstrakte Mandukya-Upanishade und die entsprechend sachlich, intellektuell-abstrakte, pur wahrheitsorientierte Sprache von Gaudapada, wie sie sich in seinem Kommentar "Karika" zeigt, widersprechen der Möglichkeit, sich jenem Wissen in nicht-religiöser Weise nähern und es "erwerben","realisieren" zu können, kaum. Prof. Easwaran schreibt zu "AUM" im Glossar auf Seite 422: "OM  Der >> nicht angeschlagene Ton<<, der in tiefer Meditation vernommen werden kann; das heilige Wort, das Brahman bezeichnet." Wenn jemand "mantra-singend" "AUM" rezitiert, so ist das vergleichbar mit Fr. Deva Premal's "Chitananda", wo sie "Shankara's Lehre in 6 Versen" singt; es geht bei AUM-Rezitieren also offenbar um "Brahman". John Bowker schreibt in seinem Buch "Religionen der Welt" (ISBN 978-3-8310-9057-0) auf Seite 21 "Om oder Aum ist der Urlaut der Schöpfung und aller Meditationsformeln. >>3<< ist die Dreifaltigkeit der Götter der Schöpfung, Erhaltung und Zerstörung; >>O<< bezeichnet die Stille beim Erreichen von Brahman". Die übliche Lehre, wonach wennimmer etwas entsteht/entstünde, der vorherige Zustand sich auflösen müßte, eine neuer Zustand entstünde und das was dafür sorgte, daß der vorherige Zustand nicht fortdauerte, die Auflösung und das Neuentstehen zulassen müßte, kann sehr wohl auch nicht-religiös formuliert und gedacht werden. Indem auch Herr Bowker die Schreibweise von "Aum" als "Om" (2 Buchstaben dann ja "nur"!) zuläßt, zeigt sich, daß die nicht-religiöse Herangehensweise kein "Verschleiern" eines hinduistischen Hintergrunds darstellen kann; die Schreibweise "Om" würde ja jene "3-Heit", wie sie herr Bowker selber darstellte) "verschleiern" und Herr Bowker fände das anscheinend "tolerierbar" bis ok. In Gaudapada's Kommentar finden sich nunmal keinerlei religiöse Ausführungen; es ist jene andere Herangehensweise, die aus der Sichtweise der Realisation von Atman, Brahman gut-genug ist. Er geht mit jener 3-Heit von "Aum" sehr sachlich um.

Nachdem es in der Mandukya-Upanishad und im Kommentar von Gaudapada wesentlich auch um AUM geht, sei nicht verschwiegen, daß es im Zusammenhang mit "Aum" allerlei zu finden gibt und schönes Rezitieren hat zweifelsohne etwas Angenehmens, wenn's jemand nunmal mag. Aber was Andere zu "Aum" zu sagen haben, ist nunmal deren Angelegenheit. Auch über Jesus Christus gibt es allerlei unterschiedliche Auffassungen und Darstellungen; die eigene Auffassung zu vertreten, heißt nicht, daß man verschleiert, daß es auch andere Auffassungen gibt; zu Jesus Christus gibt es bekanntlich auch sehr nicht-religiöse Auffassungen und Darstellungen.

2) Ein sehr schön gesungenes "AUM" konnte man früher beim Anklicken der Begrüßungsseite von Badrinath Temple Commitee hören. In "gallery" findet man dort auch eine Ruprik "Audio", aber sie ist erst noch in Bearbeitung; evtl wird's dann dort dann ja mal wieder hörbar sein.

3) "Hari Aum" in musikalisch-künstlerischer Version findet man ua bei Mohani Heitel ("Healing Power of Mantras"), Deva Premal (auf der CD "Embrace"; hier allerdings kombiniert mit einem "Shiva AUM", was leider nicht ganz zum sachlich-nichtreligiösen Madukya-Upanishad und Gaudapa's ebenso sachlich-unpersönlich-"wissenschaftlich-nüchternen" Kommentar paßt bzw zu passen scheint; nunja "künstlerische Freiheit" oder auch anderer Blickwinkel, anderer "Ansatz", anderer "Zugang"). Ein sehr schön, langgezogen gesungenes "AUM" findet sich am Ende von "Devi Prayer", gesungen von Anuradha Paudwal, was aber als Hörprobe bei amazon, da ja am Ende des "Songs", nicht verfügbar ist.

a) Mohani Heitel singt in diesem Song  ausschließlich "Hari AUM" :

https://www.amazon.de/mohani-heitel/s?ie=UTF8&page=1&rh=i:aps,k:mohani heitel

1-16 von 146 Ergebnissen oder Vorschlägen für "mohani heitel" Die heilenden Klänge der Mantras 1. Juli 2015 ... Dhiyo Yo Nah Prachodayat/Hari Om] ...

Mohani Heitel | Mantra Mohini - The healing powers of ...


b)

Hari Om Shiva Om - Deva Premal: Amazon.de: Digitale Musik ...

https://www.amazon.de/Hari-Om-Shiva/dp/B001SWKE78

Deva Premal- Hari Om Shiva Om - Hindu Mantra - YouTube

Hörprobe: https://www.amazon.de/Hari-Om-Shiva/dp/B001SWKE78


c) Das folgende  Rezitieren des Sama-Veda beginnt ebenfalls mit "AUM"; das betreffs "Aussprache":

https://www.youtube.com/watch?v=emKzULWBjr0

d) "AUM" am Ende von "Devi-Prayer" von Anuradha Paudwal; es gilt analog dasselbe wie bei Deva Premal; dieser Link wurde hier betreffs der Aussprache vom "AUM" eingefügt; ansonsten geht es in diesem Song um die 108 Namen von "Devi":

https://www.amazon.de/Devi-Prayer/dp/B002HUAVH8

Hörprobe: https://www.amazon.de/Devi-Prayer/dp/B002HUAVH8


(Links vom 13.12.2017)

Anmerkung zu diesen Linkangaben:

Diese Linkangaben heißen nicht, daß ich empfehle, damit zu meditieren, herumzuexperimentieren usw; sie sind zur Information gedacht und sie sind nunmal leicht findbar und allgemein verfügbar. 


deutschsprachige Literatur im Zusammenhang mit Gaudapada:

Im Lüchow-Verlag erschien eine Übersetzung aus dem Italienischen: "Gaudapa, Mandukyakarika, Jenseits von Shivas Tanz, mit einem Kommentar von Raphael", ISBN 3-932761-05-7, 1.Auflage 2001, Aus dem Italienischen von Gruppo Kevala.





8) Govinda:

Yogi Govinda war der Schüler von Gaudapada und Lehrer von Shankara. Shankara überlieferte seine Lehre im "Kleinod der Unterscheidung", wo Yogi Govinda explizit erwähnt wird. Es gibt auch einen kleineren, interessanten, informativen Gesang betreffs Yogi Govinda's Lehren mit - englisch-sprachigen - Untertiteln und zwar gesungen von Swami Brahmanda Saraswati (...allerdings ist dabei offen, ob Er mit jener Tonaufzeichnung jemals einverstanden war...):

'Shri Charpata Panjarika Stotram' ('Bhaja Govindam') sung by Guru ...

www.youtube.com/watch?v=sbEDqdJSxoo
9 Jul 2009 ... Guru Dev Swami Brahmanand Saraswati Shankaracharya of ... sings this alternate version of the famous 'Bhaja Govindam' stotram attributed t.

Eine, von mir angefertigte, Übersetzung des Textes ins Deutsche findet man dann unter "Swami Brahmanda Saraswati"



9) Shankara:

Shankara lebte ca 788-820 (nach Christus) oder aber auch 688-720: "Traditionell wird 788 als Shankaras Geburtsjahr angegeben; die heutige Forschung geht jedoch davon aus, dass er etwa 100 Jahre vorher geboren wurde." und "Nach tradioneller Überlieferung stirbt er 820 in Kedarnath (heute in Uttarakhand", heißt es bei Peter Köhler, 50 Klassiker Religionen, Gerstenberg-Verlag, ISBN 978-3-8369-2617-1, Seite 130 und Seite 133. Imselben Buch wird auf Seite 133 ua "Shankara: die Katha-Upanishad. Von der Unsterblichkeit des Selbst" Frankfurt/M 2006" unter der Ruprik "Lesenswert:" angegeben. Als "Hörenswert" wird imselben Buch ebenfalls auf Seite 133 genannt: Philip Glass, Satyagraha, Oper 1980 (Text nach der Bhgavad Gita, gesungen auf Sanskrit)

Shankara war  Schüler von Yogi Govinda.


Die Höhle bei Joshimath in der er angeblich meditiert - und anscheinend auch Erleuchtung gefunden  - haben soll (Quellenangabe zum Foto:  https://vedanta-yoga.de/maharishi-mahesh-yogi/. Es heißt dort ua "Alle Inhalte meiner Seite stehen dir kostenfrei zur Verfügung und sie dürfen unter Angabe der Quelle gerne weiter verwendet werden!"  :

 

 

 

 

Höhle in der Shankara angeblich 2 Jahre lang meditiert haben soll.


Er hinterließ zahlreiche schriftliche Werke, ua einen bedeutenden Kommentar zur Bhgavad Gita, einen Kommentar zu den Brahmasutras von Vyasa, das Bhaja Govdindam, diverse Stotras, aber auch das Kleinod der Unterscheidung; außerdem hinterließ Er jene 4 "Lehrstühle"/Lehrzentren, die als erste seine 4 Hauptschüler Vartikakara, Hastamalaka, Padmapada und Trotaka (-> Jothirmath/Nordindien; Badrinath-Tempel) dann inne hatten. Angeblich faßte Er auch mal seine Lehre in gerade mal 6 Versen zusammen, welche Frau Deva Premal gesanglich darbietet in ihrem Album  "Love is Space" als "Chidananda":

Deva Premal - Song of Shiva - YouTube

www.youtube.com/watch?v=r5Ca-VIzQH0
15 Sep 2012 ... Adi Shankara, of the eighth century, summarized the entirety of Advaita Vedanta in six stanzas. ... (Chidananda Rupa Shivoham Shivoham)

(Der Song kann ua bei amazon.de preisgünstig heruntergeladen werden. In der CD-Ausgabe ist vermutlich der Text mit dabei: Love is space, Chidananda, https://www.amazon.de/Chidananda/dp/B001SWMFIO/ref=sr_1_4?s=dmusic&ie=UTF8&qid=1518513346&sr=1-4&keywords=Love+is+space%2C+Deva+Premal; Link vom 13.12.2018

Nachem ich auch keine Reklame für die Firma "Amazon" machen möchte, sei extra darauf hingewiesen, daß man diese CD auch bei                        http://devapremalmiten.com/love-is-space/  - der Link ist vom 13.2.2018 - probehören und erwerben kann.

Selbstverständlich gibt es diese CD auch in Ladengeschäften, zB "Oneness World", München, im Zentrum, Damenstiftstraße - am 13.8.2018 gab es jenes Ladengeschäft jedenfalls - zB zum Erwerb, as aber wiederum nicht heißt, daß ich für den Erwerb derselben etc Reklame machen möchte; es ist eben in aller Sachlichkeit und Objektivität und so. )

Oder auch in anderer Fassung von  Uma Mohan; siehe zB:                    https://gaana.com/song/bhavani-ashtakam

( Probehören und preisgünstig sowie fair gegenüber der Sängerin herunterladbar auch bei amazon unter: Uma Mohan,Divine Chants of Shiva ,Nirvana Shatkam,https://www.amazon.de/dp/B00BEE5TV6/ref=dm_ws_tlw_trk9; Link vom 13.2.2018 )



(Den Text kann man an verschiedenen Stellen im Internet in Sanskrit und Englisch finden; etwa bei:

https://onecommunityranch.org/divine-music-project-chidananda-by-deva-premal-video-and-lyrics/
“Chidananda” by Deva Premal Video

oder auch als PDF-Datei bei:

Lyrics of Nirvana shatakam with translation - Vedic Yagya Center
vedicyagyacenter.com/.../NirvanaShatakamLyrics-withtranslation...

Chidananda Rupah Shivoham! Shivoham!! I am not mind, intellect, ego and ... Aham Nirvikalpo Nirakaara Roopah. Vibhur Vyapya Sarvatra Sarvendriyanaam.)


Eine deutsche Übersetzung dieser 2 Texte wurde von mir, auf der Basis von 8 Jahren Schulenglisch (Gymnasium) angefertigt:


https://onecommunityranch.org/divine-music-project-chidananda-by-deva-premal-video-and-lyrics/

“Chidananda” by Deva Premal:

Erst der Text auf Sanskrit
dann  Translation Englisch
dann  Übersetzung ins Deutsche:

Chidananda roopah shivoham shivoham     
– I am eternal bliss, I am shiva                                                                                - Ich bin ewige Glückseligkeit - Ich bin shiva.

Chidananda roopah shivoham shivoham     
–  I am eternal bliss, I am shiva                                                                              -   Ich bin ewige Glückseligkeit - Ich bin shiva.

Manobuddhi ahamkara chita ni naham
– I am not the mind, intellect, ego nor consciousness
- Ich bin nicht der Geist/Verstand, nicht der Intellekt, nicht das Ego, noch bin ich das Bewußtsein

Nachashotre jiv-hey nachaghrana netre     
– I am not the ears, tongue, nose or eyes
- Ich bin nicht die Ohren, Zunge, Nase oder auch  Augen

Nacha vioma bhoomir na tejoe na vayu     
- I am not space, earth, fire or wind
- Ich bin nicht Raum, Erde, Feuer noch bin ich Wind




Chidananda roopah shivoham shivoham     
– I am eternal bliss, I am shiva                                                                               - Ich bin ewige Glückseligkeit - Ich bin shiva.
Chidananda roopah shivoham shivoham     
–  I am eternal bliss, I am shiva                                                                               -   Ich bin ewige Glückseligkeit - Ich bin shiva.

Nachaprana saugno na vã puncha vayu     
– I am not breathing power,
-  Ich bin nicht die Kraft des Atmens,

Navah sapto dhatoo navaa puncha koshah  
–  the seven metals, nor the five covering
-   die sieben grundlegenden Gewebe ("sapto dhatoo"), noch die fünf Hüllen (puncha kosha)

Na waak pani paadam nachapasta paayu  
– I am not speech, hands, feet nor the rectum
-  Ich bin nicht Sprache, Hände, Füsse noch der Mastdarm





Chidananda roopah shivoham shivoham     
– I am eternal bliss, I am shiva                                                                                - Ich bin ewige Glückseligkeit - Ich bin shiva.

Chidananda roopah shivoham shivoham     
–  I am eternal bliss, I am shiva                                                                               -  Ich bin ewige Glückseligkeit - Ich bin shiva.

Na me dvãsha rago na me lobha mo-hoe  
–  I am not envy, anger, nor craving nor attraction
-  Ich bin nicht Neid, Ärger, heftiges Verlangen noch Anziehungskraft

Mado naiva me naiva matsarya bhava     
-  I am not arrogance nor pride nor religion,
-  Ich bin nicht Arroganz, noch Stolz, auch nicht Religion,

Na dharmo na chartoe na kaamo na moksha  
–  wealth, lust nor liberation
-  nicht Wohlstand, Lust noch Befreiung





Chidananda roopah shivoham shivoham     
– I am eternal bliss, I am shiva                                                                                - Ich bin ewige Glückseligkeit - Ich bin shiva.

Chidananda roopah shivoham shivoham     
–  I am eternal bliss, I am shiva                                                                               -   Ich bin ewige Glückseligkeit - Ich bin shiva.

Na punyam na paapam na saukyum na dhukham  
–  I am not virtue, sin, joy nor sorrow
-  Ich bin nicht Tugend, Sünde, Freude noch Kummer

Na mantro na tirtham name daa na yug na ha     
– I am not mantra, pilgrimage, offering, nor ritual fire
-  Ich bin nicht Mantra, Pilgerfahrt, Spende/Opfergabe noch rituelles Feuer

Aham bhoja namnaiva bhojyam na bhokta  
-  I am not food, the eating, nor the one who eats
-  Ich bin nicht Nahrung, der Vorgang des Essens noch derjenige, der ißt.





Chidananda roopah shivoham shivoham     
– I am eternal bliss, I am shiva                                                                                -  Ich bin ewige Glückseligkeit - Ich bin shiva.

Chidananda roopah shivoham shivoham     
–  I am eternal bliss, I am shiva                                                                               -   Ich bin ewige Glückseligkeit - Ich bin shiva.

Na mrootyur na shanka na me jaati bheda
–  I am not death, doubt, nor discrimination of cast
-   Ich bin nicht Tod, Zweifel noch Rassendiskriminierung

Pita naiva me naiva maata na janma
–  I am not father, mother or birth
-   Ich bin nicht Vater, Mutter, auch nicht Geburt

Na bandhur na mitram gurunaiva shishya  
-  I am not brother, nor friend, nor guru, nor aspirant
-  Ich bin weder Bruder, Freund,  Guru noch Bewerber/Anwärter







Chidananda roopah shivoham shivoham     
– I am eternal bliss, I am shiva                                                                               -  Ich bin ewige Glückseligkeit - Ich bin shiva.

Chidananda roopah shivoham shivoham     
–  I am eternal bliss, I am shiva                                                                             -   Ich bin ewige Glückseligkeit - Ich bin shiva.

Aham nirvekalpo nirakaara roopo  
–  I am beyond concept, beyond form
-  Ich bin jenseits von Vorstellung/Idee, jenseits von Form

Vibureviapya sarvatra sarvendriyani  
–  I am all-pervading in all the senses
-  Ich bin alldurchdringend in allen Sinnen

Sadame samatvah na muktir na bandha  
–  I see equality in all things, I am neither liberated nor in bondage
-  Ich sehe Gleichheit in allen Dingen, ich bin weder frei noch Sklave von                   Jemandem





Chidananda roopah shivoham shivoham     
– I am eternal bliss, I am shiva                                                                               - Ich bin ewige Glückseligkeit - Ich bin shiva.

Chidananda roopah shivoham shivoham     
–  I am eternal bliss, I am shiva                                                                            -   Ich bin ewige Glückseligkeit - Ich bin shiva.






Chidananda:

Die Übersetzung  bei  "Lyrics of Nirvana shatakam with translation" , Vedic Yagya Center, ist etwas anders und, wie mir scheint, etwas mehr orientiert an den traditionellen Vorstellungen. Sie läßt sich als "Sankrit - Englisch" -Version im Internet als "PDF-Datei" finden.
siehe: PDF]Lyrics of Nirvana shatakam with translation - Vedic Yagya Center
vedicyagyacenter.com/.../NirvanaShatakamLyrics-withtranslation...


1.Ich bin nicht Geist/Verstand, Intellekt, Ego und auch nicht die Erinnerung.
 Ich bin nicht die Handlungsorgane (Ohren, Zunge, Nase, Augen und Haut)
 Ich bin nicht die 5 Elemente (Himmel oder auch Äther, Erde, Licht oder auch Feuer, der  Wind,   das Wasser)
Ich bin höchste Glückseligkeit und reines Bewußtsein, Ich bin Shiva, ich bin völliges Glück.

2. Ich bin nicht Lebensenergie, noch die 5 vitalen Atem, noch die 7 grundlegenden Gewebearten, noch die 5 Hüllen des Körpers
Ich bin nicht das Sprachorgan, weder Hände noch Füsse, auch nicht die Fortpflanzungsorgane und auch nicht die Organe der Ausscheidung.
Ich bin höchste Glückseligkeit und reines Bewußtsein, Ich bin Shiva, ich bin völliges Glück.

3.
Ich haben keinen Hass noch Abneigung, weder Gier noch Vorliebe, auch nicht Täuschung
Ich habe keinen Stolz, keine Überheblichkeit, auch keine Eifersucht.
Ich habe keine Pflichten zu erfüllen (dharma), noch begehre ich nach irgendwelchem Reichtum oder irgendwelchen Vergnügungen (kama), ich habe auch keine Befreiung (moksha).
Ich bin höchste Glückseligkeit und reines Bewußtsein, Ich bin Shiva, ich bin völliges Glück.

4. Ich habe weder Tugend, noch Laster, weder Vergnügen noch Schmerz.
Ich brauche keine Mantras (heilige Gesänge), noch Pilgerreisen, noch Schriften (Vedas), Rituale und auch keine Opfer (Yagyas).
Ich bin weder der Erfreute, noch der sich Erfreuende, noch die Erfreuung.
Ich habe das höchste Glück, das eine Form aus reinem Glückseligkeitsbewußtsein einem bieten kann (chidananda Rupah); ich bin eins mit Glück.
Ich bin höchste Glückseligkeit und reines Bewußtsein, Ich bin Shiva, ich bin völliges Glück.

5. Ich habe keine Angst vor dem Tod, noch bin ich sterblich. Ich habe keine Zweifel über meine Existenz, noch hänge ich Kastenunterschieden an. Ich habe weder Vater noch Mutter, ich habe keine Geburt.
Ich habe keine Verwandten, keinen Freund, keinen Guru und auch keinen Schüler.
Ich bin höchste Glückseligkeit und reines Bewußtsein, Ich bin Shiva, ich bin völliges Glück.

6. Ich bin formlos und ohne all die Dualitäten.
Ich existiere überall und durchdringe alle Sinne.
Stets bin ich derselbe.
Ich bin weder frei noch gebunden.
Ich bin höchste Glückseligkeit und reines Bewußtsein, Ich bin Shiva, ich bin völliges Glück.


Nachdem der Text anscheinend, je nach Browser oder auch Bildschirm, immer wieder zu verrutschen scheint, hier noch eine verrutschungsinvariante Form:



Chidananda von Shankara, ins Deutsche übersetzt von Franz Rickinger, München 1/2018




Anmerkungen von mir:

"Shivo 'ham", also  Ich bin Shiva" und "Ich bin shiva" stehen sich hier gegenüber; einmal ist "Shiva" als Subjektiv in Gebrauch und das andere mal als "Adjektiv". Was ist richtig?

Nun, man kann ja mal versuchen aus so einem Text sich einen "passenden Reim" zu machen; was hätte ein Text einen Sinn oder auch gar tieferen Sinn , der in sich widersprüchlich, chaotoisch odgl wäre? Es ist richtig, daß es bisweilen an einem selber liegt, wenn man einen Text nicht versteht, als widersprüchlich ansieht oder auch als chaotisch.

Wenn nun jemand sich von "Ich bin Das, Du bist Das, all dies ist Das" - jenem berühmten Satz aus der indischen Geisteswelt - an obiges "scheinbare oder ja auch echte Dilemma"  zu näheren versucht, so stellt man fest, daß eigene brauchbare Meditation - TM ist hier nicht auszuschließen -  einen zu einem gewissen Vertrautwerden mit "absolutem, reinem Bewußtsein" führen kann und insofern zu einem "Ich bin Das"; im Zuge weiterer Meditationsausübung kommt es dazu, daß dieses "Vertrautwerden" auch im Bereich der Sinneswelt stattfindet und zu einem "Ich bin das", Du bist das" führen kann.

Aber was dann? "Ich bin der Andere auch? - so ein Blödsinn!" ist das selbstverständliche Resultat auf dem Hintergrund "absoluten, reinen Bewußtseins".

Also war man es weder so ganz wirklich selber, noch ist es der Andere so ganz selber - nein es gibt eben ein absolutes, reines Bewußtsein, das ein eigenständiges, unabhängiges, gänzlich freies und stets frei bleibendes Etwas nunmal offenbar ist. Es ist jenseits und in allem, es ist alles und doch ist man man selber und der Andere ist und bleibt der Andere selber; man wurde - wenn man sich das frägt allenfalls -  "mehr man selber", da man nun ja eine größere Fülle der Wahrheit über einen selber und die Welt kennen und wertschätzen gelernt hat. Im Übrigen ist  man es nicht geworden, sondern schon stets gewesen und hatte sich nur nicht darum gekümmert .(Vgl. Tat Wale Baba's zitierte und übersetzte Ausführungen).

Wenn man dann mit jenem aus sich selbst heraus, unabhängig existenten absoluten, reinen Bewußtsein näher vertraut wird - durch fortgesetzte Meditation ( TM ist hier nunmal nicht ausgeschlossen) -, könnte man sich ja vorstellen, daß es Wesen gibt, die damit und mit seiner Fülle, seinen Eigenschaften, seinen Möglichkeiten viel vertrauter sind als man selber es bis dato wurde. Gott/Götter/GöttInnen würden evtl dann eben leben, daß sie Jenes  in seiner Fülle, brahman sind und aber doch auch wieder nicht auch; gerade so als wie man jenes "Absolute, reines Bewußtsein" als "Eigenes, absolutes, reines Bewußtsein" erst "miss- oder auch teilverstand" und dann erst erkannte, daß es aus sich selber heraus existiert, unabhängig von einem, usw, gerade so wie man erkannte daß man es ist und doch auch wieder nicht auch, weil es aus sich selber heraus existiert und ein/eine Andere(r) per Meditation (zB TM, siehe auch "Swami Shantanand Saraswati sprach") damit vertraut Gewordene(r) es analog ist und doch wieder auch nicht auch, weil es sonst widersprüchlich wäre, gar keine eigene wirkliche Existenz haben könnte, man selber auch nicht und diese Welt der Vielfältigkeiten gar nicht sein könnte, usw usf. Insofern wären dann eben "Gott/Götter/GöttInnen" jenes absolute, reine Bewußtsein in dessen Fülle, jenes brahman, aber eben auch nicht wieder auch, weil ein anderer Gott, eine andere GöttIn es eben auch ist und das so in aller Wahrheitsgemäßheit realisieren konnte und lebt. (....Sie wären brahman und brahman wäre in Ihnen und jenseits von Ihnen und stets es selber, wäre die "formal-logische" Analogie dazu...).

"Ich bin Shiva" und "ich bin shiva" erscheinen so dann beide schlüssig verstehbar. Auch für  Shiva gälte, daß jenes absolute, reine Bewußtsein in Ihm ist, jenseits von Ihm und dass es in Ihm und jeneseits von Ihm in dessen Fülle ist und macht durchaus einen grundsätzlichen Unterschied zu einem menschlichen "Ich bin das, Du bist das", aber Shiva und so ein Mensch haben etwas Gemeinsames, etwas was sie beide kennen und was für beide in Ihnen und jenseits von Ihnen ist/wäre.

Da das absolute, reine Bewußtsein stets es selber in seiner Fülle ist, so wäre jenes absolute, reine Bewußtsein nur aufgrund mangelnden Wissens der nach Wahrheit über jene Thematik Strebenden, halt einfach "nur" absolutes, reines Bewußtsein und als das wahrheitsgemäß erkannt, aber eben nicht in der Fülle. Mag sein, daß Herr Shankara irgendwann merkte, daß Er jenes absolute, reine Bewußtsein in weniger und mehr Fülle zu realsieren  vermochte und so zum Ergebnis kam, daß es evtl sowas wie die "Fülle des Brahman" in sich und jenseits von sich auch zu realisieren gäbe, ohne daß Er sich damit selbst zu Gott machte, in aller Bescheidenheit, Wahrhaftigkeit und ohne  Größenwahnsinn, Allmachtswahn etc und da verstand Er dann eben evtl, daß insofern Shiva nun in Ihm war und jenseits von Ihm und insofern war Er mit "Ihm voll einig", "eins" und das weil jenes absolute, reine Bewußtsein nunmal überall in seiner Fülle ist und bleibt. (... Bei Herrn Patanjali findet man in seinem Yogasutren die Aussage, wonach der "Keim der Allwissenheit und Allmacht - der in allen Lebewesen ist - in Gott seinen Höhepunkt gefunden hat"...)

Insofern könnte Shankara frohgemut gesagt haben: "Ich bin Shiva" oder auch "ich bin shiva"; je nach Betrachtungsweise ergibt beides Sinn und das ohne Widerspruch: "Ich bin absolutes, reines Bewußtsein" versus "Absolutes, reines Bewußtseins, das aus sich selbst heraus existiert durchdrängt mich und ist in mir sowohl auch jenseits von mir; es ist im Anderen und auch jenseits des/der Anderen" ist beides wahr. ("Wow, jetzt bin ich ein Donavan, eine Tina Turner" könnte einE jungEr Solo-MusikerIn zB sagen, wenn Sie/Er ihren/seinen ersten Schallplattenvertrag-Vertrag bekommen hätte; es ist salopp gesagt und meint doch nur "Ich bin nun/vorerst wenigstens schon mal Musik-Profi so wie Donavan, Tina Turner Musik-Profis sind"; regt sich da schon jemand groß über die sprachliche Ausdrucksweise auf? - Nein. Wieso also sollte man sich über "ich bin Shiva" versus "ich bin shiva" groß aufregen? Vielleicht war jene "Sprechweise", solche "Ausdrucksweise"  damals ultra-modern, "in". Vielleicht schrieb Herr Shankara das in einem Moment überquellender Freude, vielleicht verstehen es Übersetzer nicht so ganz oder können es - mangels eigener Realisation jenes absoluten, reinen Bewußtseins, etc - nicht realitätsbezogen verstehen, da jenes absolute, reine Bewußtsein für sie zwar evtl eine als "möglich" "begreifbare Realität" ist, aber keine "Wirklichkeit".

Kali, wird beispielsweise auch als "Göttin der Zeit" bezeichnet und ist selbstverständlich selber "unsterblich", also "zeitlos"; insofern ist Kali "Zeitlosigkeit". Wenn zB Buddha das "Nirvana" erlangte, jenseits von Geburt und Wiedergeburt, aber nicht endgültigem Tod, sondern Unsterblichkeit - durch seine Erkentnis - fand, so hätte er sagen können:      "Ich bin kali" im Sinne von und nur in diesem Sinne: "Ich bin zeitlos". Er hätte aber auch sagen können: "Ich habe Kali" im Sinne von und nur in diesem Sinne: "Ich habe Zeitlosigkeit". Er hätte - weil Er ja nicht der Alleinbesitzer, der Monopolist von "Zeitlosigkeit" ist bzw sich als das nicht bezeichnen kann oder auch möchte oder auch wollte und das Wörtchen "haben" da irgendwie dann ja, aufgrund seiner Vieldeutigkeit, höchst deplaciert erscheint - aber auch sagen können, weil jene Zeitlosigkeit nunmal ihn höchstpersönlich selber betrifft: "Ich bin Kali" dh, "ich bin Zeitlosigkeit" - und das geradeso wie andere sagen "Ich bin ein Wesen aus Fleisch und Blut" und evtl noch  kürzer sagen "Ich bin Fleisch und Blut" - und insofern wäre offenbar Zeitlosigkeit in Ihm, ein entscheidendes oder auch das entscheindende Merkmal seines Daseins  - schon immer gewesen, nur nicht erkannt gehabt - und insofern wäre Kali in Ihm und Er in gewissem Sinne in Kali oder auch mit Kali, wie man es eben bezeichnen will. Als "Zeitlosigkeit erlangt habend" könnte Er sagen  "Ich bin Kali" und als "in oder auch mit Kali seiend" könnte er sagen "ich bin kali-ig" und in jenem Sinne auch "ich bin kali".

Mit Shiva ist es ähnlich; wie Gaudapada in Karika darlegte sind Zerstörung, Auflösung & co "Folge von Täuschung" und insofern zerstört Shiva nicht, löst nicht auf. (...Man könnte sich Shiva als liebenden Vater vorstellen, der das Spielzeug wie für eigene Kinder verantwortungsvoll - damit/aufdaß niemand später aus Unachtsamkeit darüber stolpere - wegräumt bzw freundlicherweise wegräumt, damit, aufdaß es wieder gefunden werden kann von jenen wenig achtsamen, vorausschauenden Kindern....)

Entscheidend ist doch, daß man sich wahrheitsgemäß mit jenen Thematiken befaßt, sich nicht in Irrtümer verrennt, nicht Täuschungen erliegt, nichts für nicht-existent erklärt, was doch existiert, nichts zur Täuschung erklärt, was aber wahr war/ist, usw.



Im Vorwort zu "René Descartes, Meditationen, Abhandlung über die Methode, marixverlag, ISBN 978-3-86539-066-0, 2. Auflage 2011, heißt es im Umschlag vorne ua:

" Als erstes Philosoph in der abendländischen Geschichte erhebt René Descartes den Zweifel zum methodischen Prinzip der Wahrheitsfindung. Absolute Gewissheit hat das Individuum allein von der eigenen Existenz, da der Denkakt ein denkendes Subjekt vorraussetzt, wovon jene berühmte Formel >> ich denke, also bin ich<< zeugt. Auf der Basis diesen Wissens kann der Mensch mithilfe seiner Vernunft zu metaphysisch, physikalisch und moralisch wahren Aussagen über die Wirklichkeit gelangen." (Descartes machte leider noch den Fehler, Tieren und Pflanzen Bewußtsein abzusprechen.....)



Zu "Shivo 'ham" heißt es im  "Spirituellen Wörternbuch Sanskrit Deutsch," von Dr. phil. Martin Mittwede, verzeichnet in der deutschen Nationalbibliografie. (hhtp://dnb.ddb.de; Link vom 9.3.2018) ISBN 978-3-932957-81-9 :

>> wörtl.: "Shiva (bin) ich"; dieser Mantra bezeichnet die identifikation des relativen, begrenzten Bewußtseins mit dem absoluten, reinen Bewußtsein. <<

Zu "shiva" heißt es u.a.
>> adj. und m gütig, freundlich; gnädig, segensreich; der Gütige, der Freundliche; der Gnadenvolle, Gnädige; Shiva wird in den Shaiva-Traditionen als der Höchste Herr verehr; <<




Im Kleinod der Unterscheidung von Shankara ( zB Bernd Helge Fritsch, ISBN 9783842363786, 2011, Verlag "Books on Demand GmbH") heißt es zB 

Auf Seite 67 heißt es ua: >> 55. Maya wird auch die große Illusion genannt. Sie hat keinen Anfang und wirkt jenseits aller Wahrnehmungen ....<<,

Auf Seite 67 heißt es dann, schon sehr an "TM-Lehre-Aspekte" erinnernd:  >>57. Durch die Erfahrung des Brahman, des Einen ohne ein Zweites, kann man das Spiel der Maya durchschauen",

auf Seite 98 findet man ua: "Die Illusion endet durch klare Unterscheidung von dem was wirklich das Selbst ist und was nicht. Das geschieht, wenn die  Identität der eigenen Seele mit Brahman erfahren wird. Dann endet die Täuschung wie ein Traum beim Erwachen" (..also die Welt als Art "Traum"....),

auf Seite 106:  >>147. Brahman kann weder verlassen noch erreicht werden. Es ist jenseits von Gedanken und Worten, unermeßlich, allumfassend, ohne Anfang und Ende. Er ist höchste Herrrlichkeit <<,

auf  Seite 127  findet man >> 197. Das ganze Universum welches der Mind wahrnimmt, ist nichts als Brahman; Es gibt nichts außerhalb von Brahman, so wie Krüge und Gefäße aller Art aus Ton bestehen. Nur Täuschung verursacht die Unterschiedung von "Du" und "Ich"<< (also ganz Ähnlich wie im Yogavasishta).

Auf Seite 136 findet man, davor warnend Mr. Mahesh's "Physik-Parallelen"  rein pyhsikalisch zu nehmen: >> 231. >> "Materie" und "Zeit" sind irrige Vorstellungen der Menschen. Sie teilen damit das Unteilbare und erkennen nicht das zeitlose Selbst<<


Bhavani Ashtakam:

Von Shankaracharya.org
http://www.shankaracharya.org/bhavani_ashtakam.php


Bhavani Ashtakam

By Sri Adi Sankaracharya, Translated by P. R. Ramachander

Vorwort von P.R. Ramachander (Anm.von mir) :

This great Sthothra by Adhi Sankara would move any one who reads it to tears. If a great soul like Him, had to describe himself, thus, Imagine the state of an ignoramus like any one of us.

Bhavani Ashtakam


Na thatho, na matha, na bandur na datha,
Na puthro, na puthri , na bruthyo , na bartha,
Na jayaa na Vidhya, na Vruthir mamaiva,
Gathisthwam, Gathisthwam Thwam ekaa Bhavani.

Neither the mother nor the father,                              
Neither the relation nor the friend,                             
Neither the son nor the daughter,                                
Neither the servant nor the husband,                           
Neither the wife nor the knowledge,                           
And neither my sole occupation,                                 
Are my refuges that I can depend, Oh, Bhavani,         
So you are my refuge and my only refuge, Bhavani.   

Weder auf Mutter noch Vater,                                                                                                 Weder auf die Beziehung noch den Freund,                                                                            Weder auf den Sohn noch die Tochter,                                                                                    Weder auf DienerInnen noch Ehemann,                                                                                  Weder auf die Frau noch das Wissen,                                                                                      Und auch nicht meine Arbeit, mein Beruf; auch nicht Ledigbleiben                                      sind meine Zuflucht, auf die ich mich verlassen kann, oh, Bhavani                                       Du also bist meine Zuflucht, meine einzige Zuflucht, Bhavani.                                            



Bhavabdhava pare , Maha dhukha Bheeru,
Papaatha prakami , pralobhi pramatha,
Kam samsara pasa prabadha sadaham,
Gathisthwam, Gathisthwam thwam ekaa Bhavani.

I am in this ocean of birth and death,
I am a coward, who dare not face sorrow,
I am filled with lust and sin,
I am filled with greed and desire,
And tied I am, by the this useless life that I lead,
So you are my refuge and my only refuge, Bhavani.

Ich bin in diesem Ozean von Geburt und Tod,                                                                      Ich bin ein Feigling, der sich Sorgen nicht zu stellen wagt,                                                  Ich bin voller Lust und Sünde,                                                                                               Ich bin voll Gier und Wünschen,                                                                                           Und ich bin gebunden durch das nutzlose Leben das ich lebe,                                             Du also bist meine Zuflucht, meine einzige Zuflucht, Bhavani.                                          





Na Janaami Dhanam, Na cha dhyana yogam,
Na janami thathram, na cha sthothra manthram,
Na janami poojam, na cha nyasa yogam,
Gathisthwam, Gathisthwam thwam ekaa Bhavani

Neither do I know how to give,
Nor do I know how to meditate,
Neither do I know Thanthra*,
Nor do I know stanzas of prayer,
Neither do I know how to worship,
Nor do I know the art of yoga,
So you are my refuge and my only refuge, Bhavani

Weder weiß ich, wie man gibt,                                                                                       
noch weiß ich wie man meditiert.                                                                                  
Weder kenne ich Thanthra *,                                                                                          
noch weiß ich Gebetsverse.                                                                                            
Weder weiß ich wie man verehrt, ehrt, Lob und Anerkennung ausspricht,                    noch weiß ich die Kunst des Yoga.                                                                                
Du also bist meine Zuflucht, meine einzige Zuflucht, Bhavani.                                    

Na janami Punyam, Na janami theertham,                                                                          Na janami mukthim, layam vaa kadachit,
Na janami bhakthim, vrutham vaapi maatha,
Gathisthwam, Gathisthwam, thwam ekaa Bhavani.

Know I not how to be righteous,
Know I not the way to the places sacred,
Know I not methods of salvation,
Know I not how to merge my mind with God,
Know I not the art of devotion,
Know I not how to practice austerities, Oh, mother,
So you are my refuge and my only refuge, Bhavani

Nicht wissend wie ich rechtschaffend sein kann,                                                                  Nicht wissend  den Weg zu den heiligen Plätzen,                                                                 Nicht wissend Methoden der Befreiung, Erlösung,                                                              Nicht wissend wie ich meinen Geist in Einklang, Hamonie mit dem Geist Gottes bringen                                                   kann, mit dem Geist Gottes vereinen kann,                         Nicht wissend die Kunst der Hingabe,                                                                                  Nicht wissend, wie man Askese praktiziert, sich in Disziplin übt, Oh Mutter,                    Du bist also meine Zuflucht, meine einzige Zuflucht, Bhavani.                                         



Kukarmi, kusangi, kubudhi, kudhasa,
Kulachara heena, kadhachara leena,
Kudrushti, kuvakya prabandha, sadaham,
Gathisthwam, Gathisthwam, thwam ekaa Bhavani.

Perform I bad actions,
Keep I company of bad ones,
Think I bad and sinful thoughts,
Serve I Bad masters,
Belong I to a bad family,
Immersed I am in sinful acts,
See I with bad intentions,
Write I collection of bad words,
Always and always,
So you are my refuge and my only refuge, Bhavani                                              

Vollbringe ich schlechte Taten,                                                                                  Verkehre ich bei Schlechten,                                                                                                Denke ich schlechte und sündhafte Gedanken,                                                                    Diene ich schlechten Herren,                                                                                                Gehöre ich zu einer schlechten Familie,                                                                                Mich in sündhafte Handlungen vertiefend,verstrickend,                                                       Sehe ich aus falschen Absichten heraus,                                                                               Schreibe ich Ansammlungen schlechter Worte, Hasskommentare,                                      Immer und immer wieder,                                                                                                     Du bist also meine Zuflucht, meine einzige Zuflucht, Bhavani. 



Prajesam, Ramesam, Mahesam, Suresam,
Dhinesam, Nisidheswaram vaa kadachit,
Na janami chanyath sadaham saranye,
Gathisthwam, Gathisthwam thwam ekaa Bhavani


Neither Do I know the creator,
Nor the Lord of Lakshmi,
Neither do I know the lord of all,
Nor do I know the lord of devas,
Neither do I know the God who makes the day,
Nor the God who rules at night,
Neither do I know any other Gods,
Oh, Goddess to whom I bow always,
So you are my refuge and my only refuge, Bhavani

Weder weiß ich den Schöpfer,                                                                                             noch den Gott von Lakshmi.                                                                                               Weder weiß ich den Gott aller,                                                                                            noch weiß ich den Gott von Devas.                                                                                    Weder weiß ich den Gott der den Tag schafft,                                                                    noch den Gott der die Nacht regiert.                                                                                   Weder weiß ich irgendwelche anderen GöttInnen,                                                              Oh Göttin, die ich stets anerkenne, vor der ich mich fortwährend verneige.                      Du bist also meine Zuflucht, meine einzige Zuflucht, Bhavani.                                        

 

Vivadhe, Vishadhe, pramadhe, pravase,
Jale cha anale parvathe shatru madhye,
Aranye, saranye sada maam prapahi,
Gathisthwam, Gathisthwam, thwam ekaa Bhavani.

While I am in a heated argument,
While I am immersed in sorrow,
While I am suffering an accident,
While I am traveling far off,
While I am in water or fire,
While I am on the top of a mountain,
While I am surrounded by enemies,
And while I am in a deep forest,
Oh Goddess, I always bow before thee,
So you are my refuge and my only refuge, Bhavani

Während ich in einer hitzigem Debatte bin,                                                                       während ich versunken bin in Sorgen,                                                                               während ich ein Unglück erleide,                                                                                       während ich weit weg fahre,                                                                                               während ich in Wasser bin oder auch  umgeben von Feuer,                                               während ich auf dem Gipfel eines Berges bin,                                                                    während ich umgeben bin von Feinden                                                                               und während ich in einem tiefen Wald bin,                                                                         Oh Göttin, Dich anerkenne ich stetst, vor Dir verneige ich mich fortwährend                   Du bist also meine Zuflucht, meine einzige Zuflucht, Bhavani.                                        


Anadho, dharidro, jara roga yuktho,
Maha Ksheena dheena, sada jaadya vakthra,
Vipathou pravishta, pranshata sadhaham,
Gathisthwam, Gathisthwam, thwam ekaa Bhavani.

While being an orphan,
While being extremely poor,
While affected by disease of old age,
While I am terribly tired,
While I am in a pitiable state,
While I am being swallowed by problems,
And While I suffer serious dangers,
I always bow before thee,
So you are my refuge and only refuge, Bhavani

Obschon ich Waise bin,                                                                                                     obschon  ich äußert arm bin,                                                                                              obschon ich betroffen bin von Krankheiten infolge des hohen Alters,                          obschon ich schecklich müde bin,                                                                                 obschon ich in einem mitleidserregendem, bedauernswerten Zustand bin,                      obschon ich von Problemen überwältigt werde                                                                 und obschon ich das Ausgeliefertsein an ernsthafte Gefahren erleide,                               ich anerkenne Dich stets, ich verneige mich stets vor Dir,                                                  Du bist also meine Zuflucht, meine einzige Zuflucht, Bhavani.



Nachdem der Text anscheinend, je nach Browser oder auch Bildschirm, immer wieder zu verrutschen scheint, hier noch eine verrutschungsinvariante Form:

 

 

 

 

 

 

Bhavani Ashtakam,.... ins Deutsche übersetzt von Franz Rickinger






Anmerkung von mir:  


1) Wenn denn da jemand all das (noch) nicht weiß und kann, was hier aufgezählt wurde, so frägt man sich woher so jemand denn dann wissen könnte, daß da eine sog. Bhavani sicherlich  helfen würde können, zweifelsohne verfauenswürdig sein würde - und nicht (mehr oder auch weniger) darauf aus ist, die Not anderer zu missbrauchen - und als Zuflucht geeignet wäre und eben nicht ein "vom Regen in die Traufe" die Folge so einer Zuflucht sein würde? Angesichts dieses Nicht-Wissens bietet sich nunmal sog. "strategisches Denken" an, womit man sich in der Mathematik jedenfalls in den Fachgebieten "Entscheidungstheorie", "Spieltheorie" und "Vektoroptimierung" befaßt. "Bhavani" ist eben ein als existent gemutmaßtes reines, unsterbliches, umfassend wissendes Wesen und mit so einer mutmaßlichen Existenz vernünftig umzugehen hieße - ua -, in einem pragmatisch-vernünftigen Rahmen zu bleiben und nicht in Fantatismen der einen oder auch anderen Sorte zu verfallen. (Siehe dazu auch den Menüpunkt "Das Gut-mögliche" .)   


2a) eine gesangliche Darbietung, mit englischen Unteriteln,  findet man etwa                                     von Mohani Heitel, Smirti-Verlag:                                                                                         https://www.youtube.com/watch?v=2qlI3e4URDE  (Link vom 8.1.2018)                   

   b)  mit französischen Untertiteln findet man sowas zB bei:                                                     https://www.youtube.com/watch?v=06onUUREGBU (Link vom 8.1.2018)            

   c) eine gesangliche Darbietung von Uma Mohan findet man zB bei:                                             https://www.amazon.de/Divine-Chants-Shakti-Uma-Mohan/dp/B0050M9JAK/ref=sr_1_6?ie=UTF8&qid=1520606207&sr=8-6&keywords=Uma+Mohan%2C+Shakti            (Link vom 8.3.2018; mit der Möglichkeit zum  Herunterladen dieses Songs zu einem              "Üblichen", moderaten "Herrunterlad-Preis")


3) Der Verfasser stellt u.a ein umfassendes Nicht-Wissen dar; aber woher dann die              Gewißheit, daß es jene "Bhavani" wirklich geben sollte? Kommt der Refrain einfach        nur aufs Geratewohl daher, basierend auf Hörensagen, oder kann so ein Refrain aus          normaler, allgemeinanerkannter Vernünftigkeit, ähnlich wie jene der nicht gerade           gedankenleeren und insofern nicht ohnmächtigen, bewußtlosen Einsicht in die               missliche Lage entspringen? Ist der widersinnig erscheinende Refrain gar nicht                widersinnig?

* Alles was einem in der Welt des Wachzustandes begegnen kann, könnte einem auch  in der Welt des Träumens begegnen. Insofern könnte diese Welt des Wachzustandes ja     eventuell auch nichts anderes als eine Traumwelt sein, sagt einem also die eigene             Erfahrung - ohne daß es dazu hochkomplizierter Philosophie odgl bedürfte.

Dagegen ließe sich einwenden, daß es doch absurd wäre, ein ganzen zB 80-Jahre-Leben in einer Nacht träumen zu können. Nunja, aber Prof. Dr. Albert Einstein erklärte, daß "Zeit" ebenfalls relativ wäre und die Zeit für ein Objekt, daß sich mit nahezu Lichtgeschwindigkeit bewegt sehr viel langsamer vergehe. Das wurde haben auch Untersuchungen an Teilchen mit sehr geringer Lebensdauer ergeben. Wieso kamen die vom Weltall aus überhaupt auf der Erdoberfläche in jener Menge noch an? Weil sie sich sehr schnell bewegten und daher deren "Eigenzeit" viel langsamer ablief als wie die "Erdenzeit", wird als Erklärung allgemein akzeptiert. Man errechnete auch, daß die Astronauten, die erfolgreich um Mond flogen, aufgrund deren Reise-Tempos am Ende ihres Erdenlebens ca 1/2 - 2 sec "älter" geworden sind, als sie ansonsten wären. Auch bei den sog. GPS-Satelitten wird die "spezielle Relativitätstheorie" beachtet  und das "Funktionieren" derselben können jene, die es benutzen/nutzen kaum leugnen. So weit so schön, wer also im Traum sich eben relativ schnell bewegen täte, weil er/sie/zwi an Bord eines geeignet schnell fliegenden Planeten irgendwo im Weltall wäre, für den verginge analog gerade mal 1 Traumperiode einer einzigen Nacht, obwohl nach "Erdzeit" zB 80 Jahre vergangen wären. Es kann daher in der Tat so sein, daß, daß diese, sog. "allgemein bekannte", Welt hier nur eine Art Traum wäre.



* Nachdem diese Welt also aus dem gemacht sein könnte, aus dem Träume gemacht         sind, könnte diese Welt aus reinem, absolutem Bewußtsein gemacht sein,

* Nachdem ein göttliches Wesen, falls es sowas denn überhaupt geben sollte, sozusagen   per Definition, der Natur des Begriffes wüßte, woraus diese Welt gemacht ist, wüßten     es  göttliche Wesen, Gott folglich, wenn sie denn "nur" eine Art Traumwelt sein sollte.

*  Wäre diese Welt denn nun aber eine Art Traumwelt, so wären selbst Leiden, Krankheit,usw nur scheinbar, wären letztlich nicht in Wirklichkeit existent, sondern "nur so existent als wie irgendwelche Dinge oder auch Personen in Albträumen.

*  Nach dem Aufwachen wird/würde unschwer und wirklich,wahrheitsgemäß die             Traumhaftigkeit und Nicht-Wirklichkeit selbst eines "Erlittenen","Durchlebten" erkannt   und man würde unschwer anerkennen, daß es keinerlei realen, wirklichen, absolut      notwendigen Grund gegeben hätte/hatte, dem Albtraum ein Ende zu bereiten oder           auch etwa den Albtraum in einen super erfreulichen Super-Traum zu verwandeln.

* Na klar, könnte es dann eben auch "Tod und Wiedergeburt" geben, weil der Tod in zB   einer Albtraum-Welt nichts - häufig oder auch nur bisweilen - als das Aufwachen in der   wirklichen Welt, einer für wirklich gehaltenen Welt zur Folge hat. Von dort wird man     sich wieder in Traumwelten begeben - beim nächsten Schlafen - und insofern gäbe es       dann halt auch Geburt- und Wiedergeburt, wenn denn die wirkliche Welt doch auch nur   eine Art Traumwelt  gewesen sein sollte, was man nicht auszuschließen                             vermochte/vermag.

* Ebenso könnte es auch so sein, daß Taten in der "wirklichen Welt" zu Träumen während des Schlafens führen, bis hin zu Albträumen. Insofern kann eben auch ein "Gesetz des   Karma" nicht ausgeschlossen werden und dessen Möglichkeit ist vernünftigerweise anzuerkennen.

*  Nachdem deshalb nicht einmal aus dem Vorkommen von Leiden in dieser Welt auf die  Nicht-Existenz göttlicher Wesen, Gottes geschlossen werden kann, kann                     vernünftigerweise und unschwererweise grundsätzlich nie&nimmer auf eine                     grundsätzliche Nicht-Existenz göttlicher Wesen/Gottes geschlossen werden. Göttliche     Wesen, Gott könnte es also geben. 

* Die Wahrheit über die Natur dieser Welt könnte offenbar nur jenseits von Wachen, Träumen und Schlafen   und insofern per "transzendentalem Bewußtsein", "Turiya", absolutem Bewußtsein, Samadhi per richtiger Meditation, jenseits des zB Mantras und insofern per einem "Transzendieren" gefunden werden. Es ist aber nicht auszuschließen, daß es jenen "Ausweg",sowas wie "Erleuchtung", sowas wie jenes "Erwachen" und damit auch jene "Erlösung", "Befreiung" von Leid und Tod geben könnte.



Insofern ist der Refrain "Du bist also meine Zuflucht, meine einzige Zuflucht, Bhavani"   vernünftig und so realistisch, wie das Andere auch alles.


Wenn man, aus puren Vernunftgründen also die Möglichkeit der Existenz göttlicher, unsterblicher, erleuchteter Wesen, Gottes einräumt, so sieht man sich in  der Situation, daß man es mit "etwas" zu tun hat, worüber man nichts genaues weiß, aber wovon man anzunehmen hat, daß es das geben könnte, dh man hat es mit einer Situation eines "Spiels gegen einer unbekannten Gegenspieler/Mitspieler" zu tun und aus dem Bereich der Mathematik gibt es dazu - abstrakt, logisch höchst präzise erarbeitete - Konzepte, um damit vernünftig, erfolgreich umgehen zu können.                                                                      

Professor Dr. Behringer brachte folgendes Einführungsbeispiel zur „Spieltheorie“ in seiner Vorlesung über die „Spieltheorie“(an der TU München):                                                Jemand darf einen Verkaufsstand machen, muß 4 Wochen vorher jedoch sagen was Er verkauft, also zB Eiscreme und Regenschirme. Er weiß aber das Wetter nicht im Vorhinein. Jedoch weiß Er zB, daß Er bei einer Entscheidung für Eiscreme an Sonnentagen ca 80.-€ verdienen werde und an Regentagen noch ca 20.-€. Er weiß aber auch, daß wenn er sich für Regenschirme entschiede, er an Regentagen 100.-€ Verdienst mit nachhause nehmen könnte; allerdings weiß er ebenso, daß er an Sonnentagen keinen einzigen Regenschirm verkaufen könnte, also lediglich 0.-€ Gewinn erzielen könnte. Wie soll man sich entscheiden? Nunja, wenn man als Prinzip das sog. "MINMAX"-Prinzip anwendet und sich so entscheidet, daß man im „ungünstigsten“ Fall den maximalen Gewinn erzeilt, so fiele die Entscheidung zweifelsohne zugunsten Eiscreme aus, da das Minimum nunmal 20.-€ beträgt, wohingegen das Minimum bei der Entscheidung pro Regenschirm der kleinere Wert, nämlich 0.-€ wäre. Die Entscheidung pro „Eiscreme“ nennt man dann die „optimale Entscheidung“, die „beste Strategie“; solche Arten von Entscheidungen nennt man „Strategien“. Hat man es mit endlich vielen möglichen eigenen Entscheidungen zu tun und mit endlich vielen möglichen Entscheidungen  des "Gegenspielers" (also dem Wetter im vorherigen Beispiel), so hat man es mit reinen Strategien zu tun. Im allgemeineren Fall, betrachtet man soundsoviel Prozent "Eiscreme" und die restlichen Prozent (maximal nunmal 100%) "Regenschirme": Jede solche spieltheoretische Aufgabenstellung läßt sich auf eine sog. "lineare Optimierung" zurückführen.

Nun hat man es in Sachen Leben, also Gott, Alltag & co nunmal aber mit mehreren Zielen gleichzeitig zu tun, die zu optimieren wären/sind: Dazu gibt es dann -leider kompliziertere – Modelle, die sich aber beim Vorliegen geeigneter Vorraussetzungen auf eine Abfolge solcher „spieltheoretischer Problemstellungen“ (daher Aufgabenstellungen  der  "linearen Optimierung") zurückführen, dh im ersten Schritt wird am Ende aus einem Problem mit, sagen wir mal, 3 zu berücksichtigenden Zielsetzungen, ein Problem  mit nur noch 2 Zielsetzungen errechnet; im nächsten Schritt erhält man dann eine spieltheoretische Problemstellung mit nur noch genau 1 Zielsetzung und die wird dann, wie gewohnt per „Linearer Optimierung“ gelöst. In jedem Fall erfüllen dann, im Falle „Vektoroptimierung“ und Wahl des Lexmaxmin-Prinzips die optimalen Stragegien gleichzeitig 3 Optimalitätskriterien; solche LEXMAXMIN-optimalen Strategien sind optimal im Sinne von MAXMIN-Prinzip (s. "Spieltheorie" = "2-Personen-Nullsummen-Spiel"), Pareto-Optimierungsprinzip („Vektormaximum“) und auch im Sinne des X-Kriteriums von Prof. Dr. Behringer. Allerdings genügen umgekehrt „optimal“ im Sinne MAXMIN-Prinzip und auch Pareto-Optimalität nur in Sonderfällen als Hinreichend für „LEXMAXMIN“-Optimal. Selbst aus "X-optimal" folgt in der Allgemeinheit noch nicht LEXMAXMIN-optimal.

Salopp gesagt, wird man aber zum Ergebnis gelangen, daß man keinesfalls ein Narr sein will, wenn es Gott und auch das/ein "Gesetz des Karma", "Wiedergeburt" und auch einen praktikablen Ausweg aus dem Leiden geben sollte. Sollte es denn anders sein, will man aber auch kein Narr sein. Man weiß ja nur, daß es Gott geben könnte, Wiedergeburt geben könnte, einen Ausweg aus dem Leiden geben könnte, ein Gesetz des Karma geben könnte.

Man mag ja vielleicht nicht wissen, ob die Welt ein Traum ist - wozu man evtl bei Shanakra, Rishi Vasishta, uä was las -, ob es Erleuchtung gibt, ob es Geburt und Wiedergeburt gibt oder aber doch nach diesem Leben alles vorbei ist, aber eines weiß man dabei sicher, nämlich daß man nicht der Depp sein will, wenn das eine oder auch andere oder auch mehrere derselben wahr sein sollten. Na klar will man nicht am Ende als Narr dastehen, indem man alles auf eine Karte setzte und sich ständig einzureden versuchte, sich selber vormachte, etwas zu wissen, was man aber ehrlicherweise nunmal gar nicht wußte und wovon man selber sehr genau wußte, daß man es gar nicht weiß.

Daß man "es könnte Wiedergeburt geben, die Welt könnte eine Art Traum sein, usw"  im Sinne von „gut-möglich“  bis zu einem gewissen Grade sehr wohl strategisch bewältigen kann, ist nunmal so. Außerdem werden seriöse, vernünftige Staaten dafür sorgen, daß so ein Lebensweg gangbar ist und niemand deshalb diskiriminiert werden darf; weiteres dazu unter „gut-möglich“. (….Interessanterweise hatte Herr Pythagoras das Prinzip Harmonie an den Anfang gestellt, war über die physikalischen Gesetze der Musikinstrumente bei „harmonischen Klängen“ zur Mathematik, den Zahlen, Zahlenverhältnissen gekommen; er zog in Betracht, daß es Wiedergeburt geben könnte und seine AnhängerInnen lebten vegetarisch. Am Ende verkündete Er, daß alles Leben Zahl sei und seltsamerweise findet man heutzutage die Informatik, welche zumindest Farben, Töne, Größen, usw allesamt als Zahlen „verwalten“ kann und stolz verkündet, daß all das „letztlich“ eine Angelegenheit  für/von „Zahlen“ sei....; siehe dazu zB das Buch "50 Klassiker, Religionen" von Peter Köhler, Gerstenberg-Verlag, ISBN 978-3-8369-2617-1, Seiten 38 - 41.

Zweifelsohne geht es im vorliegenden Lied /Text  "Bhavani Asktakam" auch um das Phänomen "Erleuchtung", "Turyia", "Yoga" und jenes  Phänomen wird damit auch zum Gegenstand einer strategischen Betrachtungsweise, welche auch in jenem Zusammenhange Fantasismus, Extremismus udgl ausschließt. Das zeigt aber auch den Wert der Überlieferung bezüglich jenes Phänomens. Würde Buddha je danach "gestrebt" haben, wenn Ihm niemand - aus Überlieferungen heraus - davon berichtet gehabt hätte? Es mag ja sein, daß jene, die es Ihm überlieferten, selber Erleuchtung nicht erlangt hatten, nicht suchten, nicht wußten, wie sie das anfangen sollten, usw und Buddha deshalb von jenen zunächst mal sehr enttäuscht war. Andererseits werden einem jene Menschen auch nicht geschadet haben, die sowas wie ein uralte Landkarte mit irgendwelchen komischen Symbolen darauf aus einer gewissen Kunstsinnigkeit oä überlieferten, und zwar schon gleich gar nicht wenn man die Symbole richtig zu verstehen verstand und einen damit  exakt bezeichneten "Schatz" finden konnte? Wäre es einem denn dann nicht gut genug gewesen, daß die Verwandeten die Karte einfach nur ganz "dekorativ" fanden und wenigstens aufbewahrten und an die nachfolgenden Generationen weitergaben? So ähnlich ist es halt auch mit den Veden udgl, die man ja auch einfach "gesanglich" betrachten und schätzen kann, ohne sie näher zu begreifen.

Dürfte man jenen, welche die Karte einst anfertigten sowie denen, die sie einfach halt nur so zuverlässig aufbewahrten weitergaben, gegenüber einfach nur elementar menschlich einfach nur ein wenig dankbar sein und das auch ausdrücken?

Sind jene, die sich daran erfreuen können und sie sozusagen als "Zierde" an die Wand ihres Zimmers hängen, nichts oder auch wenig davon begreifen deshalb "Idioten", "g'spinnerte Esoteriker", "Verrückte"? - Gewiß nicht. Aber es wäre offenbar  eine absurde Strategie, solche Menschen als "Idioten", "g'spinnerte Esoteriker", "Verrückte" zu bezeichnen und sie entsprechend zu misshandeln? Dürfte man jenne danken, die einem jenen schönen Wandschmuck überlieferten dankbar sein und das auch zum Ausdruck bringen selbst dann, wenn man die Karte auch nicht zu lesen vermochte oder aber auch mit dem "Lesen" noch nicht so ganz fertig geworden ist? Darf man analog dem Verfasser des Bhavani Ashtakam und jenen, die es überlieferten, Hochachtung entgegen bringen, sie nett oder auch toll finden und das als "Dankbarkeit" bezeichnen? Ist man deshalb ein unverbesserlicher "Spinner"? Ist man ein Idiot, nur weil man sich mit der Frage befaßt, ob es eine  "Schatzkarte" sein könnte und dieses "Hobby" mit dem Alltagsleben auf die Reihe zu bringen sich bemüht und auf "Workalkoholiker-Werdung", fanatischem "WissenschaftlerInnen-Dasein", fanatischem Christenleben udgl. zugunsten dieses seines Hobbies verzichtet und einem Lebensplan folgen gemäß "ein paar Überstunden ab und zu, nun gut; aber wenn der Chef schon von Anfang an sagt, daß man jede Woche 6-8 unbezahlte Überstunden zu machen habe und außerdem das ganze Wochenende nur noch an seinen Betrieb denken dürfe und daran, was man noch mehr dafür tun können - Nein danke!"

Solche entscheidungstheoretische Konzepte auf der obigen Basis dann auf die Möglichkeit der Existenz göttlicher Wesen, Gottes und obiger Überlegungen anwendend, hat man sich doch keiner Sekte odgl angeschlossen und auch keine Religion, Sekte usw gegründet, wenn man seine eigenen "Rechen-Ergebnisse" weitersagt etc. Und so wie es keine Sekte, Religion ergibt, wenn sich jemand an Naturgesetze hält, um nicht - aus purstem Leichtsinn - unter einer Lawine begraben zu werden, in eine Mure zu geraten, sich zu verkälten, sich tödliche Krankheiten wie "AIDS" einzufangen, usw usf, so ergibt und ergab es auch keine Sekte  und auch keine Religion, wenn man obige Überlegungen anstellt und Ergebnisse dazu kommuniziert und korrekte Ergebnisse beachtet/"befolgt".

Außerdem hat man auch die Aufgabenstellung, daß man die Möglichkeit von Geburt und Wiedergeburt sowie die Nicht-Ausschließbarkeit eines/des "Karmagesetzes"  dann also sinnvollerweise, strategischerweise ebenfalls zu berücksichtigen hat. Damit ist es dann ausgeschlossen, daß jemand aus der Aussage, wonach diese Welt eine "Art Traum" sein könnte, zu Schlußfolgerungen gelangt, die zurecht als Verbrechen bezeichnet werden und die zu ahnden man sich bemüht. (Mord, Raub, Vergewaltigung, Umweltfrevel, usw)

Selbstverständlich kann sich die Frage nach der Natur Gottes/göttlicher Wesen, seiner/derer Unsterblichkeit anschließen.


Wenn man so, die Möglichkeit göttlicher Wesen aus Gründen der Vernunft alleine       einräumt und Gott einlädt, einem behilflich zu sein in der eigenen Misere, misslichen       Lage, so ist das sehr wohl verschieden vom Ansatz der Religionen, die die Existenz eines oder auch mehrer göttlicher Wesen, GöttInnen, Göttzwi und die Verehrung, Anbetung  dieses Gottes oder auch die Unterwerfung an den Anfang stellen und dabei dann  bisweilen sogar historische Gestalten, Menschen als Gott verehren und die Worte jenes  Menschen zur unumstößlichen Wahrheit verklären/erklären und daraus allerlei  Handlungsvorschriften ableiten.  Na klar, könnte jemand Gott wahrheitsgemäß                 "gefunden" und "gesprochen" haben  und jemand könnte das ebenso wahrheitsgemäß       und korrekt  weitersagen. Wäre es denn wahrheitsgemäß gewesen, wäre man ja blöd es nicht zu beachten, zu befolgen. Allerdings bleibt da jene Unsicherheit, jenes Nicht-         Wissen bzgl der Wahrheitsliebe dessen, der da behauptet, daß es Gott Ihm/Ihr/Zwi           gesagt habe und Er/sie/zwi es korrekt weitergebe. Genaugenommen haben auch               jene es mit einer Situation zu tun, wo sie etwas nicht wissen, das sie jedoch für möglich   halten.              

Jedenfalls kann es keinen vernünftigen, anerkennbaren, wirklichen Grund für religiöse   Gruppierungen - auch nicht für Staaten - geben in  "Bhavani Ashtakam" udgl einen Angriff auf sich, eine Feindseligkeit, eine grundsätzliche Schädlichkeit oder auch Gefährlichkeit  zu sehen.


deutschsprachige Literatur im Zusammenhang mit Shankara (bisweilen auch "Cankara" geschrieben):

"System des Vedanta nach den Brahma Sutras des Badarayana und dem Kommentar des Cankara über dieselbe", 1906, F.A. Brockhaus, Paul Deussen, 540 Seiten

Bhagavad Gita, der vollständige Text ,mit dem Kommentar  Shankaras , Knaur Esoterik,, München 1989, ISBN 3-426-26447-1.

Kleinod der Unterscheidung von Shankara,Bernd Helge Fritsch, ISBN 9783842363786, 2011, Verlag "Books on Demand GmbH"

Das Kleinod der Unterscheidung von Shankara (viveka-chudamani) findet man auch auf den Seiten 37 bis 141 in dem Büchlein "Die Erkenntnis der Wahrheit", ECON, ISBN  3-612-23058-1 vom Oktober 1990.

Das Kleinod der Unterscheidung, Weisheitsbücher der Menschheit, O.W.Barth.-Verlag GmbH, 1957; die Orginalausgabe erschien 1947 bei Vedanta Press, Hollywood, Cal./USA; die autorisierte Übersetzung besorgte Ursula von Mangoldt. (damals war Mr. Mahesh noch Sekretär bei Swami Brahmanda Saraswati, lehtre nicht, sodaß diese Übersetzung wohl als unabhängig von Mr. Mahesh betrachtet werden darf)

Shankara, "Das Kleinod der Unterscheidung" (Viveka-cudamanai"), Ein Juwel indischer Weisheitsliteratur, im O.W. Barth-Programm bei Scherz, Bern; München, Wien, Scherz [1987], 159 Seiten, ISBN 3-502-33004-2, zB auch in der Stadt Bibliothek München, am Gasteig, Ebene 2.

 

 

Sieben Kleinode geistiger Erkenntnis, Heinrich Schwab Verlag, ISBN 3-7964-0175-9, 1.Auflage

1) Ein Blütenkranz von Versen über die Erkenntnis des Absoluten    (brahma-jnana-avali-mala)
2) Über die heilige Geringschätzung des Nicht-Selbst      (Anatma-sri-vigarhana-prakaranam)
3) Von Gedankenstille und vom vedischen Axiom "Ich bin Brahman, das Absolute"   (Laghu-vakya-vrittih)
4) Erklärung des vedischen Schlüsselwortes "Das bist Du"      (Vakya-vrittih)
5) Von Selbsterkenntnis     (Atma bodha)
6) Von Gotterfahrung     (Aporoksa-anubhutih)
7) Lobhymne auf die mystischen Silben der Göttlichen Mutter   (Mantra-matrka-puspa-mala-stavah)



Poesie des Vedanta, Heinrich Schwab Verlag, ISBN 978-3-7964-0198-5, 1.Auflage 2007, erstmals aus dem Sanskrit-Orginal ins Deutsche übersetzt und kommentiert von C.Rentsch

1) Zehn Strophen    (Dasa Sloki)
2) Die Erforschung der eigenen Natur    (Svarupanusandhana)
3) Acht Verse über die Gesegnten    (Dhanyastakam)
4) Die geistige Verehrung des Attributlosen    (Nirguna-mansa-puja)

Das Herz des Vedanta, Zusammenfassung der Kerngedanken sämlicher Upanishaden ( "Sarva-vedanta-siddhanta-sara-samgrahah),                             2.Auflage 2007, Heinrich Schwab Verlag, ISBN 978-3-7964-0178-7

Kapitel 1  - Die vier Erfordernisse
Kapitel 2 - Der wahre geistige Meister, der Guru
Kapitel 3 - Die Schöpfung
Kapitel 4 - Das Selbst und das Nicht-Selbst
Kapitel 5 - Das Absolute
Kapitel 6  - Meditative Versenkung
Kapitel 7 - Erleuchtung

Außerdem enthält obiges Buch:
*   " Nirvana-Satkam", was ebenfalls Shankara verfaßt hat oder auch habe.
     ("Die sechs Srophen über die Glückseligkeit im Absoluten")

Desweiteren finden sich dort 5 weitere Verse, die ebenfalls Shankara zugeschrieben werden:
*  "Maya-Pancakam "

 


Die Erkenntnis der Wahrheit, ECON, ISBN 3-612-23058-1, enthält nebst Anmerkungen, Erklräungen und Nachwort folgende ins Deutsche übersetzte"Orginal-Texte" von Shankara: 

1) "Das Kleinod der Unterscheidung" (Viveka-chudamani)

 2) "Die Erkenntnis der Wahrheit" (Tattva bodha)


Unterscheidung zwischen Selbst und Nicht-Selbst (Drigdrisyaviveka), Ansata, mit einem Kommentar von Raphael, deutsche Ausgabe 1992 Ansata-Verlag Interlaken/Schweiz, ISBN 3-7157-0156-0; die ins Deutsche übersetzte "Ausgabe erschien 1977 in italienischer Sprache.


"Die Sutras des Vedanta" oder die Cariraka-Mimansa des Badarayana nebst dem vollständigen Commentare des Cankara. Aus dem Sanskrit übersetzt. Lepizig, F.A: Brockhaus, 1887, Paul Deußen, Classic Reprint Series, Forgotten Books (siehe auch www.forgottenbooks.com)


"Hymnes a Shiva", Traduits et commentés par Jean Herbert,
Collection "LES DIEUX HINDOUS", Volume II, Editions Derain, Lyon, 1944,
(gelegentlich übersetze ich es dann aus dem Französischen)

Dann gibt es (sicherlich u.a.) auch noch einen Kommentar von Shankara zur Madukya-Upanishade und Gaudapa's Karika bei zB "forgottenbooks.com": "The Madukyopanishad with Gaudapada's Krika and the Bhshya of Shankara"


The Upanishads and Sri Shankara's Commentary, bei forgottenbooks.com:
The translation of these Upanishads as well as of Sri Sankara Uhfiryfi's commentaries thereon is in the. Hands of Pandit Ganganatha Jha, u. A. S, of Dan bhanga whose scholarly attainments and reputation, a the translator of the Tattva Kaumudi and the Yogasara Sangraha are already too well-known to the public, to need any mention on my part.
ISBN    978-1-5276-2952-3; ISBN (Cloth) 978-0-484-89046-5, auf English, 215 Seiten

Bhaja Govidam - Shankara, Text in deutsch, Sanskrit und Umschrift, 45 Seiten, broschiert, ISBN 3 - 922 477 - 03 - 8, MAngalam Verlag.

Siehe auch meine Übersetzung bei Swami Brahmanda Saraswati's gesanglicher Darbietung des Bhaja Goviddam


10) Swami Brahmanda Saraswati:

Er war Shankaracharya des Nordens von 1940 bis 1953, lt. Mr. Mahesh Prassad Varma, der - wie auch Shankaracharya Swaroopananda im Interview im Rahmen des Films "David wants to fly" bestätigt/einräumt - eine geraume Zeit dessen Sekretär war.

Von Ihm persönlich sind einige Ton- und Filmaufzeichnungen vorhanden. (siehe YouTube; Dabei ist bemerkenswert, daß am Ende jeder gesungenen Darbietung in anderem Tonfall von Ihm anscheinend auch noch die Zitatangabe "gesungen" wird. Vor Jahren wurde man auf der homepage-Seite des "Badrinath-Kedarnath--Temple-commites" mit "AUM" begrüßt; clickte man dann zB "Kedarnath" an, so wurde man von einer Gesangsdarbietung einer Sängerin begrüßt; auch sie sang am Ende, in anderer Metrik und anderem Tonfall dann - offenbar; nach vielfachem Zuhören konnte ich es heraushören - die Zitatangabe "Linga Stotram". Der guten Tradition korrekten Zitierens fühlte sich Mr. Mahesh, der sich stets auf Swami Brahmanda Saraswati bezog - dann - leider - ganz und gar nicht verpflichtet.

Zu den Tonaufzeichnungen/Videos gibt es vielfach Untertitel, sodaß man dem Inhalt zumindest per Englischer Sprache soweit folgen kann (alle diese Links vom 3.7.2017):

Guru Dev Shankaracharya Brahmananda Saraswati जय ... - YouTube

www.youtube.com/watch?v=u16wjc01ys0
22 Sep 2009 ... Movie footage of Guru Dev, Shankaracharya Swami Brahmananda Saraswati, believed to have been filmed in Lucknow, India, circa April 1952.

Sehr schön ist hier auch der Lehrstuhl  (Lehr-Stuhl) der Shankaracharyas des Nordens zu sehen. Mr. Mahesh redet anfangs was dazu und bezeichnete Ihn dabei als ein "Oberhaupt der Hindureligion"; danach kommt ein Teil einer Rede von Swami Brahmanda Saraswati in einer mir unbekannten Sprache.


'Narmada Ashtakam'  , gesungen von Swami Brahmanda Saraswati, mit englischen Untertiteln

https://www.youtube.com/watch?v=pvRdTAib1RU,  Link vom 1.10.2017

zum Erkennen des betreffenden Videos.....


https://www.youtube.com/watch?v=pvRdTAib1RU

Übersetzung anhand der englischen Untertitel:

Narmada Ashtakam
(wird Adi Shankara, (Anm. des Übersetzters: wird also Herrn Shankara zugeordnet) zugeordnet)
Acht, Narmada (Fluß), gewidmete Verse

(Anm des Übersetzters: Draht-Aufzeichnung einer Darbietung von Guru Dev, Swami Brahmanda Saraswati - 1952; damals gab es keine Tonbänder, weder die großen, noch die kleineren Tonband-Kasetten; seinerzeit wurde auf Drähte aufgezeichnet und es bedarf selbstverständlich entsprechender, alter Geräte um das abspielen zu können; diese Aufzeichnungen waren teils als "Drahtknäuel" aufgetaucht, die es dann erst mal zu entwirren galt; im Herbst 1973 sah ich mal - mir das Treiben dort mal ca 14 Tage distanziert ansehend - so ein Knäuel + die zugehörige Tondraht-Maschine in Weggis/Schweiz, wo damals Mr. Mahesh und jene wohlhabenden, finanziell unabhängigen sog "108" im Herbst/Winter lebten)

Du fließt dem Ozean mit dahinziehenden Wellen und Wassertropfen entgegen,
dein Wassser ist heilig und zerstört alle Sünden.
Du erweist Dich als Beschützer der Wesen, nachdem Du deren Angst/Ängste beseitigst hast.
Oh du großartiger Fluß Narmada ich verneige mich vor deinen Lotus-Füßen!


Du gibst den Fischen, die in deinem Wasser leben, göttliches Leben.
Du gönnst schlechten Wesen Erlösung und hilfst ihnen wie ein Förderungsmittel zur Befreiung, indem Du die Last von Sünden auf der Erde wegnimmst.                             (Anm. des Übersetzers: Na klar, Wasser bringt eine Gewichtsreduktion, insofern eine Erleichterung von der Last des Lebens auf dem Festland, dh "Erde" mit sich: Man selber hat dieselbe Masse; dennoch ist im Wasser die drückende Gewichtskraft geringer als am Festland; sogar etwas, das einem Menschen üblicherweise als so typisch "real" erscheint wie die eigene Masse, erweist sich durch  die "Begnadetheit" des Flusses - bestehend aus Wasser, Wellen, Wassertropfen mit einer realen Fließrichtung - als dennoch "relativ"; das gibt Hoffnung, daß es da in dieser Welt etwas geben würde können, was einem die schier erdrückende, drückende Last seiner eigenen Unwissenheit, Sterblichkeit und insofern "Sünde" zu nehmen die Qualität, das Wesen haben könnte).
Du bist der großartigste der Flüsse unter jenen, welche heiliges und reines Wasser haben.
Du stiftest, gewährst Insekten, die in deinem Wasser leben, Glücklichsein.
Oh du großartiger Fluß Narmada ich verneige mich vor deinen Lotus-Füßen!


Du reinigst Felder und hälst sie sauber.
Du verhinderst die Sorgen der tugendhaften Menschen, die sich vor Dir verneigen.
Du botest Markandeya, dem Sohn des weisen Mrukandu, Schutz.
Oh du großartiger Fluß Narmada ich verneige mich vor deinen Lotus-Füßen!


Dein Wasser wird verehrt und es wird ihm gedient von Markandeya, Shaunaka und anderen Weisen.
All meine Angst wird durch das Betrachten des heiligen Wassers ausgemerzt.
Du beschützt Wesen vor Sorgen  und Nöte, die dadurch bedingt sind, daß sie in den Ozean weltlichen Lebens hineingeboren wurden.
Oh du großartiger Fluß Narmada ich verneige mich vor deinen Lotus-Füßen!



Unsichtbare Wesen wie Kinnaras, GöttInnen und auch böse Geister verehren Dich wiederholt, mehrfach.
Viele Vögel zwitscheren an deinem Ufer.
Du gewährtest, ermöglichtest, stiftestes großen Weisen wie Vashishtha, Pippalada, Kardama und anderen Weisen Glück. (oder auch, anders ausgedrückt: Durch Dich fanden große Weise wie Vashishtha, Pippalada, Kardama und andere Weise Glück).
Oh du großartiger Fluß Narmada ich verneige mich vor deinen Lotus-Füßen!



So wie Honigbienen um die Blumen kreisen, den Wohlgeruch der Blüten aufnehmend, um den Nektar aufzusaugen,
hielten sich große Weise wie Sanatkumara, Nachiketa, Kashapya, Atri und Narada entspannt und sich entspannend bei Dir auf;  sie besänftigten, beruhigten, erholten sich, indem sie sich bei Dir aufhielten.
Du spendest Glück für das Glücklichsein, Du trägst Glück bei zum Glücklichsein von Lord Sonne, dem Mond, Rantideva und Lord Indra.
Oh du großartiger Fluß Narmada ich verneige mich vor deinen Lotus-Füßen!

Nachdem der Text anscheinend, je nach Browser oder auch Bildschirm, immer wieder zu verrutschen scheint, hier noch eine verrutschungsinvariante Form:

Narmada Ashtakam....ins Deutsche übersetzt von Franz Rickinger






Anmerkungen des Übersetzters:

Es ist allgemein bekannt und wird deshalb vielfach praktiziert, daß der Aufenthalt an einem Flußufer sehr erholsam sein kann. Sehr wichtig dabei ist auch, daß man nicht belästigt wird und auch dem trägt dieser Text Rechnung, indem "die Weisen", "heilig", GöttInnen udgl angesprochen werden.

Dies alles auszudrücken mag als "Binsenweisheit" angesehen oder auch diffamiert werden. Allerdings gibt es - leider - auch jene Formen von Workalkolismus die dazu führten, daß Menschen sich nicht mehr erholen, nicht mehr entspannen konnten/können, nicht mehr wußten, was sie tun könnten, um Ruhe, Erholung und Entspanung zu finden.


Zweifelsohne sollte man sich aber besser nicht am Ufer eines Flusses aufhalten, wenn eine Sturzflut im Stile einer Mure herunterkommt; das gilt insbesondere für Flüsse innerhalb entsprechend enger Bergtäler. Das Unglück (Juli 2013;
siehe etwa: Monsun: Hunderte Tote und Tausende Vermisste nach Unwettern in ...
www.zeit.de/…itgeschehen/2013-06/indien-monsun-tote
21. Juni 2013 ... Radhey Shyam, der nach Kedarnath gepilgert war, ist der einzige ... Ein Teil der Katastrophe sei hausgemacht, schrieben indische Medien.)
im Tal, durch das man zum Kedarnath-Tempel gelangt, ist dafür ein einleuchtendes Beispiel; ebenso jenes Unglück in der Taburiente-Schlucht/Kanaraen/Spanien , durch welche eine Gruppe Wanderer in den Tod gerissen wurde (siehe etwa:
Unwetterkatastrophe auf La Palma, Natters/La Palma (OTS) - Unfallbericht für La Palma, Datum des Unfalles:  20.11.2001, Unfallzeit:  ca. 14:30 Uhr
Unfallort: Barranco de las Angustias im Nationalpark der Caldera  de Taburiente; 
https://www.ots.at/presseaussendung/OTS_20011123_OTS0285/unwetterkatastrophe-auf-la-palma ).
Nun könnte es ja evtl. sein, daß es Flüsse gibt, die von der geografischen Situation so sind, daß das Problem tsunami-iger Sturzfluten, Muren uä an deren Ufern nicht vorkommt und solche Flüsse hätten insofern ein besonderes "Entspannungs-Potential", da jene Sorge bzgl. einer evtl. Flutwelle oder auch herabdonnernden Mure dort geringer oder auch gar wenigstens unbegründet wäre/sein könnte. Insofern ist es auch richtig, daß bzgl. "Erholungs-'Wert'" Flußufer nicht gleich Flußufer ist. Auch dies wird in diesem Textchen thematisiert (Ganges und Narmada werden in gewisser Weise ergänzend betrachtet).


Es ist auch zweifelsohne richtig, daß gutes Ausgeruhtsein, Entspanntsein, Erholtsein und Vermeidenkönnen von Pech, Unglück, Missgeschicken eng miteinander verbunden si
nd.



Dieser Text mag Swami Brahmanda Saraswati noch mehr gesagt haben, er mag für ihn viel tieferen Sinn auch noch gehabt haben. Aber so betrachtet, ist es keinesfalls ein absurder Text; würdevoll, sehr schön melodisch, nahezu "lautmalend" gesungen wurde es von Swami Brahmanda Saraswati allemal.
Interessant ist eben auch, daß dieser Text Swami Brahmanda Saraswati offenbar was sagte und Ihm irgendwie gefiel.






'Uma Maheshwara Stotram', gesungen von Swami Brahmanda Saraswati, mit englischen Untertiteln

https://www.youtube.com/watch?v=DwJiPaNMlLE (Link geprüft am 29.9.2017)

zum Erkennen des Links

https://www.youtube.com/watch?v=DwJiPaNMlLE (Link geprüft am 20.10.2017)


Uma Maheshvara Stotram 

Allerbeste Grüße an das göttliche Paar Shiva und Shivaa,
die gesegent sind mit stets neuer und ewiger Jugend,
deren Körper in gegenseitiger Umarmung weilen, an jeweils den Anderen sich klammernd und einander unterstützend.
Allerbeste Grüße an die Tochter von Himavan und an jenen, dessen Symbol der Stier ist.
Fortwährende Grüße an Lord Shankara und Parvati Devi.


Allerbeste Grüße an das göttliche Paar Shiva und Shivaa,
die den Sport mystischer Vereinigung genießen,
die Segen spenden, um die Wünsche ihrer  Anhänger zu erfüllen
und deren Füße sogar von Lord Narayana verehrt werden.
Ich verneige mich immer und immer wieder vor Parvati-Devi und Lord Shiva.

Allerbeste Grüße an das göttliche Paar Lady Shivaa und Lord Shiva,
die einen Stier als Freund beim Sich-Fortbewegen an ihrer Seite haben,
die verehrt werden von Lord Brahma, Lord Vishnu und Indra
und deren Körper mit Sandelholzpaste sowie mit vibhuti (Asche)
bedeckt, eingecremt sind. (Anm. des Übersetzters: Vgl. etwa den Volksstamm der Himbas in Afrika, bei denen die Frauen rote Erde, zum Schutz vor Sonnenbrand etc, auftragen und sich mit Räucherwerk als Deo behandeln.)
Ich vereinige mich wieder und wieder vor Parvati-Devi und Lord Shiva.

Allerbeste Grüße an das göttliche Paar Lady Shivaa und Lord Shiva,
die das Universums steuern,regeln und beherrschen,
die stets siegreich sind, die von Lord Indra und Anderen verehrt werden.
Ich verneige mich immer und immer wieder vor Parvati-Devi und Lord Shiva.

Allerbeste Grüße an das göttliche Paar Lady Shivaa und Lord Shiva,
die die allerbeste Medizin haben/"sind" für jene, welche von der "Samsara"-Krankheit geplagt werden,
die es genießen dem "Panchakshari" (die fünf Silben "OM Namah Shivaya") zu zuhören
und die das Universum schaffen, erhalten und verändern bis hin zur zwischenzeitlichen Auflösung.
Ich verneige mich immer und immer wieder vor Parvati-Devi und Lord Shiva.

Allerbeste Grüße an das göttliche Paar Lady Shivaa und Lord Shiva,
die vollendet schön sind, deren Lotus im Herzen im Höchsten fest verankert sind
und die wahrhaft wohltätig sind gegenüber allen in den unzähligen Welten.
Ich verneige mich immer und immer wieder vor Parvati-Devi und Lord Shiva.

Allerbeste Grüße an das göttliche Paar Lady Shivaa und Lord Shiva,
die die schlimmen Missverständnisse in Bezug auf Kali korrigieren sowie Sorgen und Ängste im Zusammenhang mit Kali überwinden helfen
(Anm. des Übersetzters: Missverständnise wie jene absurden "Tieropfer", "Tierversuche", "Kulteichen-etc"-Umhauen als nicht gottmissachtend, ja sogar auch noch als heiligartig verehren, absurdes "Macht-euch-die-Erde-untertan" udgl.) ,                                         die Körper haben, die einerseits leicht ausgehungert (wunderbar schlank, nicht überessen), etwas skeletttös (nicht unorganisiert-strukturlos, nicht skelettlos, mit allerbestem Knochenbau), vollendet schön asketisch         und andererseits alltagstauglich, günstig, voller wunderbarer Schönheit sind
und deren Wohnstatt der Berg Kailasa ist.
Ich verneige mich immer und immer wieder vor Parvati-Devi und Lord Shiva.

Allerbeste Grüße an das göttliche Paar Lady Shivaa und Lord Shiva,
Die das Unheilvolle verhindern, die einzigartig sind in allen Welten,
deren Intellekt klar und höchst fein, scharf ist, deren Gedächtnis allerbestens gesammelt, organisiert und weit zurückreichend ,tief ist.
Vor jenem Shiva-Parvati verneige ich mich immer wieder.


Allerbeste Grüße an das göttliche Paar Lady Shivaa und Lord Shiva,
die einen Wagen als Ihr Mittel zur Fortbewegung haben, deren Augen Sonne, Mond und Feuer sind.
Deren Lotus-Gesicht in ihrer Schönheit dem Vollmond ähnelt.
Vor jenem Shiva-Parvati verneige ich mich immer wieder.


Allerbeste Grüße an das göttliche Paar Lady Shivaa und Lord Shiva,
Die Jata haben (deren Haar zu einem Knoten zusammengesteckt ist), die frei von Unvollkommenheiten wie Alter und Tod sind,
die von Lord Vishnu und Lord Brahma bewundert werden.
Vor jenem Shiva-Parvati verneige ich mich immer wieder.

Allerbeste Grüße an das göttliche Paar Lady Shivaa und Lord Shiva,
die 3 Augen haben, die geschmückt sind mit Girlanden aus Jasmin-Blüten und Bilva-Blättern,
die das Universums regieren (Anm. des Überersetzters: Wissenschaftler fanden "Zufälligkeiten" als Gesetzmäßigkeiten und ob das nun "Zufälligkeiten" oder auch "Freiheitlichkeiten" sind ist wohl Ansichtssache; alleine schon insofern kann hier "regieren" nicht "kriminell-arrogantem, diktatorischem Beherrschen" gleichgesetzt sein) und wahrhaft göttliche Qualitäten  haben, die durch und durch friedlich, von unerschütterlichem Frieden durchdrungen sind.
Vor jenem Shiva-Parvati verneige ich mich immer wieder.

Allerbeste Grüße an das göttliche Paar Lady Shivaa und Lord Shiva,
welche die Jivas beschützen und regieren,
deren Herzen sich dem Schutz der drei Welten verpflichtet fühlen und wissen,
die von allen Devas und Asuras verehrt, um Rat und Hilfe gebeten werden.
Vor jenem Shiva-Parvati verneige ich mich immer wieder.


Wer auch immer diese zwölf Verse an Shiva-Parvati
mit Hingabe dreimal am Tag (am Morgen, am Mittag und am Abend) liest,
wird alle vorteilhaften Dinge erlangen, um sich hier so hundert Jahre lang erfreuen zu können
und er/sie wird bei der Befreiung in Shivaloka (einen Himmel Shivas) eingehen.


Nachdem der Text anscheinend, je nach Browser oder auch Bildschirm, immer wieder zu verrutschen scheint, hier noch eine verrutschungsinvariante Form:


 

 

 

 



 

 

 

 





'Guru Pranaam', kleiner Teil der Guru-Puja, gesungen von Swami Brahmanda Saraswati

https://www.youtube.com/watch?v=Zy-V37unzrU (Link geprüft am 29.9.2017)


'Shri Charpata Panjarika Stotram' ('Bhaja Govindam), gesungen von Swami Brahmanda Saraswati, mit englischen Untertiteln

 

 

 

 

zum Erkennen des Videos



https://www.youtube.com/watch?v=sbEDqdJSxoo  (Link geprüft am 29.9.2017)                                                           https://www.youtube.com/watch?v=sbEDqdJSxoo  

(Diese Tonaufnahmen sind, zumindest teilweise, per Ton-Kabeln, ca 4 mm dicken, runden Metallkabeln dereinst gemacht worden.)

Übersetzung anhand der englischen Untertitel:

Du kommst um dem "Shri Charpata Panjarikaa Stotram" zu zuhören.                              Tag und Nacht, Morgen und Abend, Winter und Frühjahr sind wieder gekommen,          Die Zeit spielt und das Leben schwindet dahin,                                                                  aber selbst dann hört der Wind des Verlangens nicht auf.                                                   Hör Dir mal an, was Govinda zu sagen hat, hör Ihm mal zu, sei nicht voreingenommen  Govinda gegenüber, Du Narr!

Vor dem Feuer und hinter der Sonne,                                                                                 in der Nacht ist das Gesicht den Knien nahe,                                                                     Almosen in die Hand erhaltend, unter Bäumen lebend                                                      Selbst dann lassen die Fesseln des Verlangens nicht los.                                                    Hör Dir mal an, was Govinda zu sagen hat, hör Ihm mal zu, sei nicht voreingenommen  Govinda gegenüber, Du Narr!  

Solange ein Mensch in der Lage ist Wohlstand zu verdienen,                                            ist die Familie Ihm fest verbunden.                                                                                     Später, in einem alten Körper lebend, kümmert sich niemand mehr um Ihn.                     Hör Dir mal an, was Govinda zu sagen hat, hör Ihm mal zu, sei nicht voreingenommen  Govinda gegenüber; Du Narr!           

Einige mit geflochtenen oder auch verfilzten Haaren,  andere mit kahlgeschorenem       Kopf,                                                                                                                                   einige mit Frisuren, manche ockerfarben gekleidet, andere in verschiedenartigen            Kleidern,                                                                                                                              obgleich sehen könnend, sieht es der Narr nicht;                                                                die unterschiedlichen Erscheinungsweisen sind nur für das Verdienen des                        Lebensunterhalts bzw sind Folge davon.                                                                             Hör Dir mal an, was Govinda zu sagen hat, hör Ihm mal zu, sei nicht voreingenommen  Govinda gegenüber, Du Narr!

Ein bischen Gita studierend,                                                                                               Sogar einen Tropfen Gangeswasser trinkend,                                                                    wodurch der Verehrung für Muraari (Krishna) Genüge getan wird;                                  sein Tod wird nicht zum Thema, er wird nicht sterben.                                                       Hör Dir mal an, was Govinda zu sagen hat, hör Ihm mal zu, sei nicht voreingenommen  Govinda gegenüber, Du Narr!

Die Glieder sind schwach, der Kopf ist grau,                                                                     der Mund ist zahnlos,                                                                                                          der alte Mann hält/benutzt einen Stock;                                                                              selbst dann trennt Er sich nicht vom Verlangen, läßt es nicht weichen, läßt es sich nicht  nehmen.                                                                                                                               Hör Dir mal an, was Govinda zu sagen hat, hör Ihm mal zu, sei nicht voreingenommen  Govinda gegenüber, Du Narr!                                                                                            

Während der Kindheit ist ein Junge vollauf beschäftigt mit Spielen,                                 wenn er ein junger Mann ist, ist Er von jungen Mädchen voll in Anspruch genommen,   wenn Er ein alter Mann ist, ist er versunken in Sorgen;                                                      wer denn ist dann nicht versunken/vertieft in Parabrahman?                                              Hör Dir mal an, was Govinda zu sagen hat, hör Ihm mal zu, sei nicht voreingenommen  Govinda gegenüber, Du Narr! 

Wieder und wieder wird man geboren, wieder und wieder stirbt man,                               wieder und wieder schläft man im Babybauch der Mutter.                                                 In dieser Welt des Samsara, die schwierig zu durchqueren/durchschauen ist,                    beschützte mich aus unbegrenztem Mitleid oh Muraare (Krishna).                                    Hör Dir mal an, was Govinda zu sagen hat, hör Ihm mal zu, sei nicht voreingenommen  Govinda gegenüber, Du Narr!

Nacht für Nacht, Tag um Tag,                                                                                             14 Tage-Periode um 14 Tage-Periode, Monat um Monat, Jahr aus Jahr ein                       werden Verlangen und Ärger nicht aufgegeben                                                                   Hör Dir mal an, was Govinda zu sagen hat, hör Ihm mal zu, sei nicht voreingenommen  Govinda gegenüber, Du Narr!

Welcher Nutzen liegt in Sinnes-Reizen?                                                                             Wozu ist ein See gut,wenn das Wasser weggetrocknet ist?                                                 Was gibt es für die Familie, wenn der Wohlstand ausgegeben wurde?                               Welchen Sinn ergibt Samsara, wenn die Wahrheit gewußt wird?                                       Hör Dir mal an, was Govinda zu sagen hat, hör Ihm mal zu, sei nicht voreingenommen  Govinda gegenüber, Du Narr!                                                                                            

Die Brüste einer Frau sehend und die Region um den Nabel,                                            Vernarre, verknalle Dich nicht in die Erscheinungsweise dieses Fleisches,                       denke gut über dies, bedenke dies, wieder und wieder.                                                      Hör Dir mal an, was Govinda zu sagen hat, hör Ihm mal zu, sei nicht voreingenommen  Govinda gegenüber, Du Narr!

Wer bist Du? wer bin Ich? Woher kamst Du?                                                                      Wo sind meine Mutter, wo mein Vater?                                                                               Stell Dir vor, daß alles essenzlos, unwesentlich ist.                                                             Verlasse diese Welt indem Du Dir vorstellst, daß sie ein Traum                                         ist/sei.                                                                                                                                   Hör Dir mal an, was Govinda zu sagen hat, hör Ihm mal zu, sei nicht voreingenommen  Govinda gegenüber, bedenke seine Worte, Du Narr!

Die Gita kann gesungen werden, der Lord hat Tausend  Namen,                                         meditiere über die Form von "Mahavishnu"                                                                         die geistige Aktivität kann zur Ruhe kommen, der Geist kann das Unmanifeste                 erreichen  (Anm. des Übersetzers: die Meditation also "transzendentale" Meditation sein).             In der Gegenwart guter Leute kann sich der Geist den Armen zuwenden, Wohlstand         dienen.                                                                                                                                    Hör Dir mal an, was Govinda zu sagen hat, hör Ihm mal zu, sei nicht voreingenommen    Govinda gegenüber, bedenke seine Worte,Du Narr!

Solange Atem im Körper ist,                                                                                                wird man von jenen im Haus nach dem Wohlergehen gefragt,                                            aber wenn der Atem den Körper verläßt,                                                                              hat die Frau Angst vor jenem Körper.                                                                                   Hör Dir mal an, was Govinda zu sagen hat, hör Ihm mal zu, sei nicht voreingenommen    Govinda gegenüber, bedenke seine Worte, Du Narr!

Wer Glück in sexuellem Vergnügen sucht,                                                                            wenn mal Krankheit im Körper sich einstellt,                                                                       wenn man sich dem Tod hingibt,                                                                                           selbst dann wird das Sünde-Praktizieren nicht zu Ende kommen.                                        Hör Dir mal an, was Govinda zu sagen hat, hör Ihm mal zu, sei nicht voreingenommen    Govinda gegenüber, bedenke seine Worte, Du Narr!

Gekleidet in Lumpen von der Straße,                                                                                    geht der Wallfahrer einen Weg jenseits von Tugend und Sünde;                                         weder Du noch Ich noch diese Welt existiert;                                                                       warum sollte Er also bekümmert sein?                                                                                  Hör Dir mal an, was Govinda zu sagen hat, hör Ihm mal zu, sei nicht voreingenommen    Govinda gegenüber, bedenke seine Worte, Du Narr! 

Jemand erholt sich am "See der Ganga",                                                                               jemand übt sich in strenger Askese oder wendet sich Wohltätigkeit zu oder stiftet auch,    aber alles spricht dafür, daß man ohne Kenntnis des SELBST                                             auch in Hundert Jahren mukti (Befreiung) nicht erreichen wird.                                          Hör Dir mal an, was Govinda zu sagen hat, hör Ihm mal zu, sei nicht voreingenommen    Govinda gegenüber, bedenke seine Worte, Du Narr! 

Om tat sat iti sarvam astu, om höchste absolute Wahrheit, es soll ein Ende haben, laß das Ende von allem erlangt werden.




  

 




usw.

Shankaracharya Shantanand, sein - auch von Mr. Mahesh akzeptierter - Nachfolger (Shankaracharya Shantanand Saraswati ist leider nicht ohne "Gegen-Papst" geblieben; vielleicht ganz informativ und interessant dazu ist Folgendendes, das jedoch noch ins Deutsche übersetzt werden muß: Swami Swaroopanand speaks on Shankaracharya Swami Brahmanda Saraswati http://paulmason.info/gurudev/sources/text/SwamiSwaroopanand.htm Swami Swaroopanand Saraswati Swami Swaroopananda was born Pothiram Upadhyay on September 2nd 1924, in the Jabalpur area of Madhya Pradesh. At nine years old he left home to visit the holy places of India, including Varanasi where he eventually studied with Swami Karpatri  - aka Hariharananda Saraswati - , a disciple of Guru Dev Swami Brahmananda Saraswati. Bzgl Swami Swaroopananda siehe auch:)


), veröffentlichte dann mal eine Sammlung von Zitaten von Swami Brahmanda Saraswati, der sein Lehrer gewesen war, unter                                                                                   "108 discourses of Guru Dev":


Im Internet findet man viele Informationen bei:

108 Discourses of Guru Dev: Life & Teachings of Swami ...
www.amazon.com/…ru-Dev-Shankaracharya/dp/0956222803
108 Discourses of Guru Dev: Life & Teachings of Swami Brahmananda Saraswati Shankaracharya of Jyotirmath (1941-1953) Vol. I [Paul Mason] on ...

http://oaks.nvg.org/gurudev-teachings.html
Mason, Paul. 108 Discourses of Guru Dev: The Life and Teachings of Swami Brahmananda Saraswati, Shankaracharya of Jyotirmath (1941-53). Vol 1. Penzance, Cornwall: Premanand, 2009. ⍽▢⍽ Paul Mason has done a wonderful job in gathering and publishing material about Guru Dev, and also of Guru Dev. I recommend his very rewarding books.


Wenn man jene Literatur so durchliest, so fällt auf, daß es zumindest eine sehr religiöse Sprache war, wie Er lehrte. Ich spreche Ihm damit keinesfalls ab, daß Er religionsphilosophische Lehren Shankaras udgl in der gebotenen Sachlichkeit, Abstraktheit und Universalität darlegen konnte. Es kommt halt immer auch darauf an, was von wem wie wann warum überliefert wurde.


Das folgende Foto wurde in Allahabad, während einer Kumbha Mela aufgenommen, wahrscheinlich zwischen 1948 und 1950. Es zeigt Swami Brahmanda Saraswati zusammen mit dem Shankarcharya von Sringeri:

Swami Brahmananda Saraswati, Shankaracharya des Nordens von 1940 bis 1953 und der Shankaracharya von Sringeri, anläßlich einer Kumbh Mela (vermutlich zwischen 1948 und 1950)

 



11) Swami Shantanand Saraswati:

Er war Shankaracharya von 1953 bis 1980.

Infos findet man bei:

i)  https://www.ouspenskytoday.org/wp/the-record-of-shankaracharya-audiences/

A RECORD OF AUDIENCES & CORRESPONDENCE
WITH HIS HOLINESS SHANTANANDA SARASWATI
SHANKARACHARYA OF JYOTISH PEETH
1960 – 1993

All Rights Reserved              
FOR PRIVATE STUDY ONLY

Indexes: © Jenny Beal 2016

( Eine Aufzeichnung aus/von Audienzen und Korrespondanz mit "seine Heiligkeit"/ "seiner Exzellenz" Shantananda Saraswati Shankaracharya von Jotish Peeth, 1960-1993

Alle Rechte vorbehalten. Nur für private Studien

Verzeichnis/Register/Index:  ©  Jenny Beal, 2016)

oder auch:

ii) Profile of Shankaracharya Swami Shantanand Saraswati - www ...
www.paulmason.info/gurudev/Shantanand.htm
Shankaracharya Swami Shantanand Saraswati A Brief Biography & Bibliography with mention of the Jyotirmath succession disputes - compiled by Paul Mason.

Darunter findet sich "Sayings of Shantanda" (..als PDF-Datei..), was wohl mindestens so interessant und authentisch ist als Mr. Mahesh's Darstellungen von Lehren des Herrn Swami Brahmanda Saraswati. Allerdings wurde Swami Shantanda  von Swami brahmanda Saraswati zu seinem Nachfolger bestimmt, was den "Sayings" von Swami Shantanand ein höheres Gewicht verleiht als die Lehrdarstellungen des Mr. Mahesh,  der langjähriger Privatsekretär von Shankaracharya Swami Brahmanda Saraswati gewesen war.

In Sayings of Shantanand geht es um Meditation. Die Frage, die sich daran unweigerlich anknüpft ist, ob solche Yogawissen nun die Basis für Hinduismus ist oder Hinduismus die Basis für Yoga, ist Yoga der Hintergrund des Hinduismus oder ist der Hinduismus der Hintergrund für Yoga. Nun wer will das schon genau wissen, wer war bei der Entstehung schon dabei? Aber offensichtlich ist die sachliche, nicht-religiöse Qualität des Wissens über Meditation, wie es Shankaracharya Shantanand, der - im Gegensatz zu Mr. Mahesh - eine offizielle Lehrbefugnis von Swami Brahmanda Saraswati erteilt bekommen hatte, darzustellen vermochte und darlegte. Das könnte eigentlich ebenso gut als Vortrag in einem TM-Center ad "TM gehalten worden sein.

Hier eine, von mir angefertigte, Übersetzung von "Sayings of Shantanand"; siehe bzgl. englische Fassung:

>> sayings of swami shantanand saraswati - Paul Mason

www.paulmason.info/.../Sayings%20of%20Swami%20Shantanan...

SAYINGS OF SWAMI SHANTANAND SARASWATI. Meditation. The whole of our mind has for so long been associated with the outer world that it has quite <<  (Google-Ergebnis am 4.10.2017)

oder auch bei:  http://www.paulmason.info/gurudev/Shantanand.htm (Link-Angabe funktionierte am 4.10.2017)



b) "Sayings of Shantanand"

es folgt meine Übersetzung ins Deutsche:

Swami Shantanand Saraswati sprach:

Meditation:

Der gesamte Geist, unsere gesamte geistige Aktivität war so lang verbunden mit der äußeren Welt, daß er ganz die Existenz vergaß und die innere Welt alleine ließ/vernachlässigte. Der aktive, sich umherbewegende Geist, die geistigen Aktivitäten sind Suche nach Glück im Erwerb und in der Erfahrung von Dingen. Diese genügen nicht, sind nicht zufriedenstellend; denn wenn der Geist eine Sache hat/erreicht hat, eilt er unverzüglich zur nächsten. Der ruhige Geist findet Glücklichsein in allem. Das innere Königreich  oder auch, anders gesagt, der Himmel im Inneren ist das Reservoir von Frieden und Glückseligkeit. Tauche mit Hingabe in jenen glückseligen Himmel, der in Dir ist, hinein und schwimme sanft und schonend/gewaltfrei/ohne Heftigkeit/harmonisch darin umher.

Wenn wir uns in die Meditation hinein begeben erreichen wir eine spirituelle Welt wo Stille, vergleichbar mit jener eines tiefen, ungestörten Ozeans, vorherrscht. Dort gibt es keine Bewegung - keine Wellen, keine Strömungen -, alles ist absolut gleichbleibend, unveränderlich. Dies ist die Welt der Meditation, des Meditierens. Wenn wir von so einer spirituellen Welt aus die Welt betrachten so sehen wir unser eigenes grundlegendes Sein oder auch SELBST überall und nichts sonst bleibt übrig.

Das bestmögliche Ende der Meditation ist es Unbewegtheit  oder auch die gründliche Stille zu erreichen, welche sehr tief ist. Mit keinem Maßsstab kann es/sie ausgemessen werden - sie/es ist ohne Ende. Es ist nicht nötig in diesem Zustand lange zu verweilen. Die meiste Zeit, die mit Meditation verbracht wird, dient dazu einen/dich in diesen Zustand zu führen/bringen. Die Stille, Ruhe selber ist die eigentliche Meditationserfahrung.

In einer Diamantenmine werden tausende Tonnen Gestein 300 Fuß unter der Erd-Oberfläche zerkleinert. Es wird in einzelne Brocken zerkleinert, nach oben gebracht, weiter verarbeitet , gewaschen und dann zum Trocknen ausgebreitet. Tausende Leute sind/werden damit beschäftigt diese kleinen Steinen herauszugreifen und zu betrachten. Dieser ganze Prozeß geht weiter und schlußendlich finden sie eventuell 100 Gramm Diamanten. Solchiges passiert auch in/per der Meditation - so muß man eine halbe Stunde aufwenden und das einfach nur um einige Momente des Kontakts mit dem SELBST zu erlangen; und das ist es wert weil man einen Diamant erhält - die reale Kraft, das wertvollste Material  jedermann's Lebens.

Das gesamte Universum ist zweigeteilt - Ich und der Rest! Dies ist die Welt der Geteiltheit und wir Leben in dieser Welt von Dualität. Die Methode der Meditation ist es, uns von Dualität zu Einheit,Einigkeit zu bringen. Diese Methode ist nicht das Ende. Es ist wie das Seil durch welches wir in den Brunnen  hineingelangen oder auch herauskommen können. Sobald das Nötige getätigt/ erreicht ist, wird das Seil zurückgelassen. Das Mantra ist nicht Einheit,Einigkeit; es führt lediglich zur Einheit, wo die Welt der Geteiltheit aufhört zu sein. Diese Einheit,Einigkeit ist das Absolute, bekannt als Wahrheit, Bewußtsein und Glückseligkeit. Wenn wir dort ankommen, findet eine wundersame Alchemie statt

(Anm. des Übersetzers: 1) Der Begriff "Alchemie" ist hier sicherlich in einem anderen Sinne zu sehen, als in den Chemiebüchern. Der Begriff "Alchemie" wird erklärt als aus dem Arabischen kommend, wo "al" ein Artikel ist und insofern "Al Chemie" nichts anders hieß als "Die Chemie". In "Natur und Technik, CVK, Chemie für Realschulen, Rheinland-Pfalz/Saarland, Gesamtausgabe, Cornelson, 1.Auflage, 1989, ISBN 3-464-05838-7" heißt es dazu auf Seite 6: >>Die Araber hatten längere Zeit Teile Europas besetzt und dem Wort Chemie den Artikel Al vorangestellt (Al-Chemie).<< 

In "Aus Natur und Technik, Chemie 9 II/III, Realschule Bayern, Cornelson, ISBN 3-464-85202-4, 1.Auflage, 2002" heißt es ad Alchemie auf Seite 8 ua.:
>> Wenn der Nil weite Teile des Landes überschwemmte, blieb der fruchtbare Schlamm zurück. Di Ägypter nannten die schwarze, vom Nilschlamm gefärbte Erde chemia.  Vielleicht wurde der Name "Chemie" davon abgeleitet.  Der Begriff chemia bezeichnete das geheimnisvolle Schwarze im Auge eines Menschen. Und vor gar nicht langer Zeit galt auch die Chemie tatsächlich als geheimnisvolle "schwarze (ägyptische) Kunst". <<....

>>Die Alchemie entstand schon vor der Zeitenwende. Sie war die Geheimlehre zur Herstellung von künstlichem Gold. Zwischen 1200 und 1500 hatte sie ihre Blütezeit. <<....
>> Bei ihren vergeblichen Bemühungen, Gold herzustellen, machten Alchemisten wertvolle Entdeckungen:<<....das weiße Porzellan.... >> Um 1520 gab der Arzt Paracelus (1493-1541) der Alchemie eine neue Aufgabe - die der Heilung von Kranken.<<
>> Alchemisten entdeckten auch wichtige neue Stoffe, so zB den Phosphor und das Ammoniak. Von den Alchemisten wurden außerdem Geräte und Arbeitsmethoden entwickelt, die heute noch von Bedeutung sind. Dazu zählen zB das Filtrieren, das Eindampfen, das Destillieren und das Kristallisieren.<<
>> Vieles konnten sich die Alchemisten nicht erklären. Sie versuchten es oft mit Beschwörungsformeln.<<
>> Chemie ist keine Zauberei! <<                                                 

Hinzukommt, daß der Chemiker Otto Hahn und nunmal kein Physiker, die "Kernspaltung" entdeckte. Die von Otto Hahn konsultierte frühere MitarbeiterIn Fr. Meitner, die vor den NAZIS hatte fliehen müssen, half Ihm beim Verstehen ganz entscheident. heutzutage weiß man aus der "Quantenmechanik" (durchaus noch fehlerbehaftet, lt. John von Neumann) bzw den ihr zugundeliegenden physikalisch-wissenschaftlichen Beobachtungen, daß Energie auch "quantenhaften" Charakter habe, dh daß man von sog. "Energiequanten" hoch-modernwissenschaftlich-offiziell sprechen könne.                                                                              

Nun lehrt die Chemie sehr wohl, daß chemische Prozesse nur dann ablaufen können, wenn dabei Energie frei wird oder zumindest die Entropie, dh Unordnung, zunimmt. Für jene chemische Reaktionen, die ablaufen, weil Energie frei wird, also zB Verbrennungsvorgänge, gilt also gemäß der modernen Physik und Chemie, daß sie nur ablaufen können, weil Energiequanten entweichen können und das Entweichen von Energiequanten untrennbar mit der Realität jenes zB Verbrennungsvorgangs (Ich beschränke mich hier auf anständige, gut-mögliche Laborsituationen!) verbunden ist. Gemäß Einsteins's E=m*c² ist jener Energie eine Masse zugeordnet, um welche die  Summe der Endprodukte leichter ist als die Summe der Ausgangsstoffe. Indem die Umgebung dabei wärmer wird, also - gemäß der kinetischen Gastheorie - die Bewegung der Atome und Moleküle der Luft im Mittel heftiger wird, nimmt also auch insofern die Unordnung  in der Umgebung zu.

Jene "entweichen-können müssende Energiequanten" erinnern nun allerdings sehr an die Alchemisten-Theorie des "Phlogistons", welche aber noch in jenem "Schulbuch", das man mir ausgehändigt hatte, als "überholt" bzw "widerlegt-worden-seiend von Herrn Lavoisier" belächelt, verurteilt wurde. Im Buch "Chemie und Mineralogie" von Ludwig, Band I, Nichtmetalle,, 1956, C.C. Buchners Verlag, Bamberg, fünfte Auflage, meinem amaligen Chemieschulbuch, heißt es auf Seite 37: "Die mit der Phlogistontheorie nicht in Einklang zu bringende , allmählich unwiderlegbar gewordene Tatsache der Gewichtszunahme beim Verbrennen brachte es mit sich, daß die Zweifel an der Richtigkeit der bisherigen Auffassung immer größer wurden. Endlich verkündete LAVOISIER, nachdem er in den Jahren 1774-1777 durch viele messende und wägende Versuche,die Rolle  des Sauerstoffs beim Verbrennungsvorgang genau untersuucht hatte, die heute noch gültige  S a u e r s t o f f t h e o r i e  der Verbrennung , die geradezu die Umkehrung des Grundgedankens der Phlogistonlehre ist, " usw.

 Ich behaupte nicht, daß die Messungen, Beobachtungen des Herrn Lavoisier falsch gewesen wären; na klar, bei der Verbrennung wurde die Ausgangssubstanz meßbar schwerer und nicht leichter; allerdings sind die entweichenden "Energiequanten" gemäß Einstein's berühmter - oder aber auch, angesichts der Atombombe udgl, berüchtigter - Formel E=mc² durchaus auch als massehabend einordenbar. Herr Lavoisier konnte das lediglich nicht messen und insofern hatten die Phlogistonisten irgendwie Recht und Herr Lavoisier auch.                                                         

  Desweiteren hat es sich im Bereich der Kernphysik - den Chemiker eröffnet/gefunden und dann nicht hatten "haben" wollen - als machbar erwiesen sogar künstlich Elemente jenseits von Plutonium etc - per Beschießen gewisser Atome mit zB Zinkkernen in Linearteilchenbeschleunigern, wie es auch einen im Forschungsgelände München-Garching gibt - zu erzeugen. Es erscheint selbstverständlich, daß es möglich ist, mit solchen und ähnlichen Methoden, aus Quecksilber tatsächlich Gold-Isotope herzustellen. Insofern wurde der "Traum" der Alchemisten, Quecksilber in Gold zu verwandeln, als prinizipiellerweise realisierbar längst nachgewiesen; dabei spielt die Quantenmechanik und insofern  Phlogiston-Theorie durchaus eine Rolle.                                                                         

Nunja, man sieht hier ein Beispiel von Irrtum, irrtümlichem, überheblichem Ablehnen von etwas, usw und aber auch ein Beispiel von absurden Träumen, da niemand wohl riskieren möchte am Ende einen Ring aus radioaktiv-strahlendem Gold am Finger zu haben und niemand was mit den unerträglichen Müllhalden, Unratsplätzen der Kernphysik etwas zu tun haben möchte!

Diese Art von Alchemie meinte Swami Shantanand Saraswati sicherlich eh nicht.

2a) Wenn hier von "Alchemistischer Verwandlung" die Rede ist,  kann man es aber nicht versäumt haben, darauf einzugehen, was das Buch "Kundalini" von Gopi Krishna (O.W. Barth-Verlag in deutscher Übersetzung zu "so was" zu berichten weiß. Herr Gopi Krishna, beschreibt wie Er, zur Überwindung seiner Trägheit und gewissen Faulheit, anfing Yoga-Übungen zu machen und dabei eines Tages "Kundalini" erweckte. Seine Yoga-Übung war jene einer "Konzentrationsübung" und evtl. war Er wenig "charmant mit sich und seinem Körper" dabei umgegangen und hatte dabei evtl Etliches in seinem Körper/Gehirn/etc zerstört/verletzt gehabt. Jedenfalls beschreibt Er, daß in seinem Fall Kundalini, Ihn angeblich nahezu zum Verhungern gebracht habe, sie angeblich durch den falschen Kanal "hochgestiegen" sei usw usf. Irgendwann, wäre es dann "Ihm" gelungen mit einer größtmöglichen Kraftanstrengung , die Kundalini in die richtige Bahn zu lenken und ab da habe ein, ihm nicht nun mehr ungeheurer, unaufhaltsamer Vorgang der Bewußtseinsentwicklung seinen Lauf genommen, den zB Prof. Carl-Friedrich von Weizsäcker in jenem Buch "die biologische Basis religiöser Erfahrung" als durchaus realistisch, sinnvoll erachtete. So ein "Transformationsvorgang" könnte also bei jedem momentanen Samadhi, wie es Swami  Shantanand Saraswati erwähnt, evtl. gemeint sein; aber eben eine sanfte, harmonische Transformation und kein scheinbar chaotischer Prozeß hervorgerufen durch gewalttätige Yogapraktiken odgl.                        

2b) Was Swami Shantanand Saraswati hier anscheinend meint hat Mr. Mahesh mal so gesagt: Wenn der Geist im reinen, transzendentalen Bewußtsein zur Ruhe gekommen ist, fängt das Verdauungsystem  an "Soma" - siehe zB Veden - zu produzieren, was dann zu einer Verfeinerung der Sinneswahrnehmung führe und den Übergang zum "Einheitsbewußtsein"  - jenes "Turiyatita" der Shivasutren bzw "Param-Atman" in der Darstellung vom Swami Shantanand Saraswati - vorbereite/ermögliche. Man könnte sagen, daß im Zustand dieses Zuruhegekommenseins im absoluten Bewußtsein, das Verdauungssystem in einen Zustand der Entspanntheit gelangt und dann subtilere Aktivitäten zu entfalten die Gelegenheit hat. Entspanntheit an sich ist nunmal nicht konkret, seiner Natur nach transzendent und jenes Soma ist wie Wellen aus/in jener transzendenten Entspannheit.  Soma kann nicht existieren ohne die gleichzeitige "Anwesenheit" von "Samadhi", jener gründlichen Ruhe jenes Turiyas, jenes absoluten Bewußtseins im Bewußtsein des Betreffenden. Es entzieht sich der Messbarkeit, aller Messbarkeitsversuche und ist grundsätzlich, weil es so ist wie es ist, nicht nehmbar und insofern auch nicht er-langbar, er-werbbar, etc.

3) Eventuell ging auch beim Übersetzen ins Englische etwas daneben; aber der Begriff "Alchemie" paßt an dieser Stelle, meiner Meinung nach, nicht. So wie es eben schon auf dem Bereich der Menge aller Teilmengen des 3-dimensionalen euklidischen Raums unmöglich ist ein "Wahrscheinlichskeitsmaß" zu definieren, dh es unmöglich ist alle jene Mengen per "Wahrscheinlichkeit" zu messen bzw die Vorstellung von "Wahrscheinlichkeit" in Bezug auf alle jene Teilmengen des R³, des 3-dimensionalen reellen, euklidischen Raumes, zu erfüllen, so kann man eben jenes Phänomen von dem Swami Shantanand Saraswati spricht, nicht mit den Mitteln des Messens und insofern auch nicht mit den Mitteln des Nehmens, Besitzergreifens, Bewertens von Messungen richtig darlegen.

Vielleicht wäre "Meta-Chemie" in Analogie zum Begriff "Meta-Physik" eine geeignete Bezeichnung, Benennungsmöglichkeit.....                                                                             

4) Im Buch "Die Welt des Tantra in Bild und Deutung" von Ajit Mookerjee und Madhu Khanna, ISBN: 9783811207028, findet sich in der mir vorliegenden ungekürzten Ausgabe für den Buchclub Ex-Libris Zürich auf den Seiten 136 bis 141 ein Kapitel über die altdinischen Vorstellungen zu "Alchemie". Allerdings kann man wohl kaum allen Ernstes Quecksilber udgl als "Stärkendes Medikament" bezeichnen, auch wenn Marco Polo und andere solche Beobachtungen bzgl Quecksilberverabreichungen schilderten. Man kommt da unmittelbar in die Problematik  jener, zweifelsohne im Widerspruch zu den yogischen Lebensidealen seienden, Tierversuche. Daß gewisse Mineralien giftig bis hochgiftig sind ist aber durch Zufälle zu einem Erfahrungswissen der Menschen auch ohne jenen absurden, grausamen Tierversuche geworden, sodaß  sich da ein "strategischer Umgang" angesichts "nicht Gewußtem" anbietet. Insofern erübrigt es sich dann als "strategisch absurd, eine Einnahme von "Quecksilber" etc in blindem Vertrauen auf alte indische Alchemie-Texte in Erwägung zu ziehen. Es scheint so, daß es zu erheblichen Fehlentwicklungen gekommen war, nachdem das Wissen über richtige Meditation, samadhi (sowohl momentaner als auch daurhafter) udgl verloren gegangen war. Im Rahmen von Mr. Mahesh's Bemühungen um Ayur-Veda kam es in Vlodropp/Niederlande leider zu üblen "medizinischen" Versuchen an Purusha-Kurs-TeilnehmerInnen. Ein dänischer Arzt hatte mal einer Gruppe von Probanden über Wochen hinweg ausschließlich Rettich als Nahrung gelassen. Ein Kursteilnehmer war darüber so verzweifelt, daß Er in der Kaffee-Maschine des Besucherzimmers (im Eingangsbereich; Besucher durften nicht in das Gebäude hinein, wie ich mal erlebte) Gerstenkörner garte; dieser Münchner TM-Lehrer (den ich kenne) verließ dann alsbald - vernünftigerweise - jene "TM-Scene" (...und machte per Arbeitsamthilfe eine Ausbildung zum "Computer-Netzwerk-Spezialisten" mit....). Inwieweit dort auch mit Quecksilber & co an "KursteilnehmerInnen" absurderweise herumexperimentiert wurde, weiß ich nicht. Mit "TM ist eine natürliche Meditationsübung, die man wie Zähneputzen zum  Alltag hinzufügt" hat all das absolut nichts mehr zu tun!

5) Daß es im Zusammenhang mit TM-Ausübung zu Kundalini-"Erweckung" kam und kommen kann, halte ich für eine Tatsache. Im Rahmen eines TM-Lehrerfortbildungskurses fragte eine TM-Lehrerin den anwesenden Mr. Mahesh bzgl. ihrer Kundalini-Erfahrungen. Mr. Mahesh gab einen absurden, unnatürlichen Rat, der krass im Widerspruch zu den Erfordernissen eines Alltagslebens steht/gestanden hätte, wenn man ihn je konsequent befolgt hätte. Mr. Mahesh fragte aber auch die Anwesenden, wer sonst noch Kundalini-Erfahrung habe und es meldeten  sich ca 25 der anwesenden über 100 TM-LeherInnen. Ich sah und sehe in Kundalini weder etwas Beängstigendes, noch Gefährliches; es entzieht sich der materiellen Wissenschaften, hat mit Krankheit 0,0 zu tun; allerdings stufen deutsche PsychiaterInnen - die davon nun wirklich keinerlei Ahnung haben und geprägt von ihrer materialistischen Weltanschauung es auch gar nie wahrheitsgemäß verstehen können - Kundalini als "schwere Krankheit" ein. Nachdem deutsche "Staatsspitzel" auch auf TM-Lehrerfortbildungskursen gewesen sein könnten, war es dumm, ja gemein, schlimm denunziativ, daß Mr. Mahesh betreffs solcher Erfahrungen - in letztlich unschwer zugänglichen Gruppen  - jemals fragte. Vonseiten der TM-Verantwortlichen kam für die, von der zB deutschen Psychiatrie deshalb, dann Verfolgten schlimmerweise noch nicht einmal anwaltliche Hilfe odgl

6) Bei mir erwachte Kundalini im Rahmen des Kurses in Kössen/Österreich im Herbst 1971, 1/2 Jahr nachdem mir TM aufoktruiert worden war. Ich empfand und emfinde sie als wohltuend und nahm sowie nehme jene "Hilfe" gerne dankend an. Im Rahmen des Fortgeschrittenpraktikums meines Studiums machte ich dann die Erfahrung, daß mich Kundalini an einem normalen 8-Stunden-Arbeitstag 0,0 behindert. Hinterher allerdings zog und ziehe ich Entspannung , entspanntes Ausklingenlassen des Tages vor. Ca 1975 im Sommer merkte ich urplötzlich, daß ich frühmorgens auf dem Weg zur Uni deutlicher sah. Im Laufe des Tages ließ die Sehkraft dann aber wieder nach. Im Rahmen der Abendmeditation erholte sich die Sehkraft wieder. im Frühjahr 1976 wurde das dann von einer Augenärztin - ohne daß ich sie vorab darauf hingewiesen - im Rahmen einer Routine-Brille-Neuverordnung bestätigt. Während ich im letzten Schuljahr 1971 schlechter als -7,5 hatte, aus der Bundeswehr im Frühjahr 1972 noch wegen schlechten Azugenlichts entlassen  worden war, stellte jene Augenärztin dann eine Verbesserung auf -5,5 hin fest. Nachdem jene Augenärztin es leider versäumt hatte mir zu erklären, daß jene Zusatzverordnung "1/4 Zylinder"  zu einer Formenverzerrung führt, ergaben sich Probleme im Alltag (Überlagerungen von Gesehenem und Gewußtem zu einem daumenkinoartigen, im Alltag hinderlichen Effekt), die ein Arzt und Psychologe - den ich in seiner Eigenschaft als Psychologen und nur als das aufgesucht hatte -, dann sofort in die Ecke "Geistesgestörtheit" rückte, statt mich in die 1 Etage unterhalb von Ihm befindliche Augenarztpraxis zur Überprüfung jener augenärztlichen Diagnose zu schicken und das obgleich ich Ihn auf die eigentümliche Dsikrepanz zwischen BW-Entlassung und des nunmehrigen Sehstärken-Befundes hingewiesen hatte. Aus dieser hocherfreulichen Auswirkungen des bischen Meditierens und Hinwendung zu yogisch-vegetarischer Ernährung machte die deutsche Psychologie und Psychiatrie  eine Katastrophe, Staatsaffaire und verfolgte und verfolgt mich deshalb aufs Brutalste. Das alles wurde anscheinend veranstaltet, um weiterhin sagen zu können "Kundalini ist gefährlich", auch wenn die Gefährlichkeit lediglich darin liegen sollte, daß man um dessentwillen vom deutschen Staat per seiner Psychiatrie, Justiz & co brutal verfolgt wird!)

und das Wesen wird mit Energie aufgeladen - gerade so wie eine Autobatterie zum weiteren Gebrauch aufgeladen wird. Falls wir, in der Meditation, nachdem wir mit dem Mantralaut begonnen haben, anfangen nach irgendwas Ausschau zu halten, vielleicht einen Ton oder auch eine Substanz, haben wir aufgehört/sind dabei aufzuhören zu Meditieren, machen wir was im Widerspruch zur Meditation. Selbst das Reden von "Wertschätzung" ist Dualität. In tiefer Meditation betreiben wir nicht einmal Wertschätzung von Friede, Wahrheit, Glückseligkeit oder auch Bewußtsein; tatsächlich werden wir friedlich, wahrheitsliebend, glückselig und unseres SELBST bewußt. Man muß alle Ideen des Wertschätzens in Bezug auf das Mantra aufgeben. Das Mantra wird auf natürliche Weise in jener Einheit zu jener Ruhe  kommen in der es keine Aktivität und Unterteilheit gibt.

Wenn man in einer ruhigen Position zur Meditation sitzt, mag es Ablenkungen von außen geben und diese Zerstreuungen,Verwirrungen, Ablenkungen ziehen den Geist an. Man beachte sie nicht. Abgesehen von äußeren Ablenkungen gibt es innere Tumulte! Diese hören nicht auf im Geist weiterzugehen/als geistige Aktivität in Erscheinung zu treten; er/sie, der Geist kehrt/die geistigen Aktivitäten kehren immer wieder zurück zu gewissen Dingen, die er tun möchte/die man tun will - es zeigt einem lediglich verschiedene "Ordner" für die eigene Betrachtung! Wenn man fast ruhig,still ist, kann diesen Einordnungen mehr Energie zuteil werden und deshalb wird man vom Geist/den geistigen Aktivitäten dahin zu bewegen versucht, es sich anzusehen. Tatsächlich ist es aber so, daß jetzt nicht die Zeit dafür ist; also treffe man eine Entscheidung - sei Dir im Klaren darüber/ mache dem Geist klar bzw kläre die geistigen Aktivitäten dahingehend , daß es nicht die Zeit für diese Einordnungen ist - "Wenn ich meine Zusammenkunft mit dem SELBST beendet habe, werde ich mich um jene zweifelsohne kümmern!" Dann befasse dich mit jenen Betrachtungen später, Lösungen bezüglich jener Fragen suchend, die den Geist zu beschäftigen scheinen. Dies ist der Weg: Man bestelle ihm was zu tun ist. Er wird den eigenen Anweisungen folgen, vorausgesetzt die Anweisungen gehen von einem aus oder auch, anders ausgedrückt, man steuere die geistigen Aktivitäten und es wird das Angesteuerte eintreten, vorausgesetzt nunmal, daß man sie steuert. Man treffe eine Entscheidung, man lasse ihn am Eingang/Tor sein und ihm sagen, keinerlei Einordnungstätigkeiten zu einem vorzulassen weil jetzt dafür nicht die Zeit ist. Man wird sich später damit auseinandersetzen. Und dann befasse man sich später auch damit.

In der Meditation ist man einfach Eines. Man wird das SELBST. Die Methode der Meditation, des Meditierens ist nur ein Vorgang wodurch das möglich gemacht wird.

Die ursächliche oder auch spirituelle Ebene der Ruhe, welche gründliche Stille und völlige Unsterblichkeit sind, ist im Bereich des Absoluten. Nachdem die ursächliche Welt nicht beschrieben werden kann, lernt man darüber von den Auswirkungen/aus den Effekten. Man kann es an den Aktivitäten und der Art/dem Charakter jener sehen, welche sich mit spiritueller Ruhe versehen. Es gibt da drei allbekannte Merkmale:

Erstes zeigen sie Liebe und Zuneigung allem und jedem gegenüber womit sie es zu tun bekommen. Alle Aktivitäten werden aus Liebe getan und dann von Liebe erhalten und ernährt bis sie zu ihrer Erfüllung gelangen. Alle Beziehungen zu Individuen oder auch Aktivitäten, direkt oder auch indirekt werden nur von Liebe und Zuneigung beleuchtet und geführt.

Zweitens sind ihre Ideen, Absichten oder auch Motive rein und einfach/nicht verkompliziert. Reinheit und Einfachheit weiten den Horizont und sie denken und arbeiten für die gesamte Menschheit und nur durch die Gesetze des Absoluten. Die Unterscheidungen nach Gruppen, Rassen oder Nationen verschwinden und lediglich natürlicher Gesetze bedienen sie sich. Ihre Gedanken umfassen natürlicherweise Das Ganze der Menschheitsfamilie und deren innewohnendes, immanentes Gutsein.

Drittens sind die physikalischen Bewegungen solcher Leute auf den natürlichen Rhythmus abgestimmt und das Ergebnis sind Einfachheit und Ökonomischheit der Bewegungsabläufe. Sie hetzen niemals in irgendeine Situation hinein, regen sich niemals auf und führen alle Handlungen in einer effizienten/wirksamen, erhabenen und verfeinerten Art und Weise aus. Was auch immer sie tun, es hat seinen Ursprung in Stille, wird von Stille erhalten und vereinigt sich wieder mit derselben Stille, die sie in dieser großartigen, vollständigen Unbewegtheit erfahren. Dies ist für den gewöhnlichen Menschen ein Ideal oder auch ein Maß bzw eine Richtlinie wonach zu streben ist, falls er/sie irgendwie zur Notwendigkeit diesen Zustand zu verbessern erwacht ist.

In der spirituellen Welt gibt es Bücher aus denen man Wissen erhält, aber mehr Wissen macht aus jemanden keinen wirklich verwirklichten Menschen. Man braucht Erfahrung. Wenn man nicht auf dem Weg geht ist Wissen darüber nutzlos. Was einem Bücher geben können das kann  ein Lehrer auch.(Anmerkung des Überetzers: Allerdings  ist es durchaus so, daß es ein Buch ermöglicht, eine gewisse Unabhängigkeit von der Lehrperson zu bewahren; wer im Schulbuch nachlesen kann, worüber der/die LehrerIn im Unterricht sprach, kann auch etwaige Ungereimtheiten, ja sogar Fehler des Lehrers/der Lehrerin finden und alsdann mit dem Schulbuch in der Hand zum Lehrer gehen und, eigene Distanz und Unabhängigkeit bewahrend, in aller Sachlichkeit die tatsächlich oder auch nur vermeintlich festgestellte Diskripanz klären, was es dann dem Lehrer auch ermöglichen sollte, seine etwaigen Fehler unpersönlich und in aller Sachlichkeit, ohne negative Konsequenzen für den Schüler/die Schülerin einzuräumen. Umgekehrt können so auch Fehler im Schulbuch entdeckt und zur Korrektur gebracht werden. Zweifeslohne hat Swami Shantanand Saraswati dahingehend völlig recht, daß ein Lehrer/eine LehrerIn das wissen muß, was in den Schulbüchern steht. Meiner Auffassung nach hat ein Lehrer/eine Lehrerin die Aufgabe, den Inhalt eines Schulbuches mit Hilfe desselben den SchülerInnen korrekt, unpersönlich und zufriedenstellend zu lehren; ein Lernerfolg hängt dabei natürlich auch vom Schüler/der Schülerin, ua. dessen Mitarbeit sowohl im Unterricht als auch zuhause, ab. So wie sich ein Lehrer/eine Lehrerin auf den Unterricht sorgsam vorzubereiten hat, so muß das auch ein Schüler/eine Schülerin tun, indem sie den Stoff der vorherigen Stunde/Stunden sich erarbeitet und regelmäßig wiederholt, sodaß er/sie mit den etwaigen in der letzten Stunde neu erklärt bekommenen Begriffen, Sachverhalten usw umgehen kann und dem Unterrichtsgeschehen tatsächlich folgen kann. Hat ein Lehrer/eine LehrerIn etwa den Satz des Pythagoras durchgenommen, einE SchülerIn hätte das Gelehrtbekommene zuhause nicht gelernt, sich nicht erarbeitet, den Satz nicht gelernt, so wird die/der SchülerIn in der nächsten Stunde, wenn der Lehrer/die Lehrerin zB Anwendungen jenes Satzes d'ran nimmt, kaum sonderlich erfolgreich mitkommen. Somit ist klar, daß man die Last des Lernerfolgs nicht auf den Lehrer abwälzen kann und eine gewisse eigene Mitarbeit - selbst in diesem ziemlich diesseitigen Lernbereich - not-wendig ist und bleibt. Einen "Nürnberger Trichter" gibt's nunmal nicht und das stellt Swami Shantanda Saraswati, im nächsten Satz, korrekterweise fest: ) Aber über alldem steht, daß - obgleich man fast alles von Anderen bekommen kann - jene Verwirklichung man nur selber erfahren kann.



Atman und Param-Atman

Atman ist universell, dauerhaft/stabil, alles durchdringend, wie Licht und bewußt. Alles was nicht Atman ist, ist begrenzt, nicht stabil oder vorrübergehend, teile-verhaftet, schwer, dunkel und nicht bewußt. Mit "Viveka" (Unterscheidungsvermögen zwischen dem was wirklich und dem was unwirklich ist, zwischen dem was von Dauer und dem was nicht von Dauer ist ( Anm. des Übersetzers: vgl auch Yogavasishta)) sieht man Atman überall und in allem zu jeder Zeit. Jemand der weise ist, jemand mit Viveka, behandelt jedermann wie sich selber und sieht das SELBST in jedermann. So jemand ist zu jederzeit immer voll Wachheit, geradeheraus, mit Fülle von Liebe und Glück.

Von gewöhnlichen Menschen wird nicht gesehen bzw verstanden, daß die Veränderungen, die stattfinden, in der eigenen Natur stattfinden und nicht im Atman. Atman unterliegt keinen Veränderungen. Jemand der das versteht wird sehr leicht,hell&klar und geht in Freiheit ohne die Last der Welt mit sich herum zu schleppen. Es ist jemand, der sich am Drama dieser Welt im  wahren Sinne (....Anmerkung des Übersetzters: also in dem Sinne, wie sich jemand an einem, zB auf einer  Theaterbühne, sehr schön, gut, lehrreich usw aufgeführten, "Drama" erfreuen kann. Außerdem ist/wäre es eine  w a h r e  Freude, wenn man weiß, daß der Weg zur Lösung gar nicht weit ist, daß es "nur", in aller Wahrheit, um die Beseitigung/Überwindung eines Missverständnisses/einem einer Täuschung-Erlegensein geht.) erfreut und sich niemals mit den Figuren des Dramas identifiziert. Unser Job ist es einfach nur zuzusehen und uns daran zu erfreuen.

Das Absolute ist die Verkörperung von Liebe, Wissen und Hingabe. Es in jeder Hinsicht grenzenlos und seine Türe steht jederzeit offen. Das Universum ist ein Ganzes und voller Liebe und alles wird von Liebe motiviert. Laßt Liebe, ohne Hindernis aus irgendeiner Richtung, strömen.

Um fähig zu sein, universelle Gnade auf Dauer zu erhalten, ist es lediglich notwendig die eigene innere Tür geöffnet sein zu lassen, offen in Richtung des Absoluten. Die universelle Gnade des Absoluten durchdringt das Universum und ist daher zu jedem Zeitpunkt verfügbar. Wenn die Erinnerung an die universelle Gnade lebendig gehalten wird, dann stellt sie eine Verbindung her und gestattet/gewährt es jenem Wesen, für die Gnade jederzeit empfänglich zu sein.



Gute Eigenschaften:

Das Mehren guter Eigenschaften ist von grundlegender Bedeutung. Die guten Eigenschaften sind diese: (1) Man sollte stets liebend gerne die Wahrheit sagen, sodaß es keine Ungleichheit gibt zwischen dem was man denkt, dem was man sagt und dem was man tut. Es sollte eine lückenlose Beziehung zwischen Ideen und Aktivitäten geben. (2) Man fördere die Liebe von Leuten und ermutige sie, ihrerseits ihre Liebe, durch gewisse Arten von Aktivitäten, zum Audruck zu bringen. (3) Man sei großmütig, hochherzig im Umgang mit jenen um einen herum.

Es gibt einen Sanskrit Vers, der besagt, daß man, durch das Verstehenlernen, daß man Teil des Universums ist und  jedermann gegenüber diese Beziehung, diese Position zu haben, man dann anderen das gibt, was man selber gerne bekommen würde. Was einen erfreut sollte zur Freude anderer verfügbar gemacht werden - oder auch handle so wie du behandelt werden möchtest!

Wir sollten es zu unserer Gewohnheit machen uns weder auf die Fehler, Mängel anderer geistig einzulassen noch auf die  an eigenen. Unsere Haltung sollte sein, sie zu übersehen und nicht zu beachten. (Anm. des Übersetzteres: Ein gutes Maß an Misstrauen kann aber zweifelsohne nicht schaden und in der "Spieltheorie" im Fachbereich Mathematik - natürlich nur wo man dieses einfache Konzept anwenden würde können - geht man vom "ungünstigsten Fall" aus und nicht vom "günstigsten Fall", sich auf diese Weise nicht blind machend für all das was passieren würde können, wenn man sich falsch entscheidet..... Swami Shantanand Saraswati erwähnte ja auch vorher: " Man sollte stets liebend gerne die Wahrheit sagen, sodaß es keine Ungleichheit gibt zwischen dem was man denkt, was man sagt und was man tut. Es sollte eine lückenlose Beziehung zwischen Ideen und Aktivitäten geben" . Der Verstand, die Vernunft sind  nunmal ein Teil des Menschen  - und Verstand, Verständniskultivieren, was Swami Shantanand Saraswati ebenfalls wenige Zeilen zuvor als grundsätzlich bedeutsam darlegte , stehen keinesfalls im Widersprach zu "Liebe" - . Swami Shantanand Saraswati sagte nunmal auch noch: ". Es sollte eine lückenlose Beziehung zwischen Ideen und Aktivitäten geben" und genau diese Beziehung hätte man nie&nimmer, wenn man blindwütig sich irgendeiner Verbrecherlust Anderer aussetzen würde, indem man die Warnungen des Verstandes außer Acht ließe. Paramahansa Yogananda, den ich nunmal nicht so sonderlich schätze, beschrieb dazu in seiner "Autobiografie eines Yogi" - durchaus erfreulicherweise und lehrreich - das Beispiel eines Mannes: Jener Mann war auf einer Straße und ein wütender, tobender Elefant - ich möchte hier keinesfalls die Elefantenschaft beleidigen; es wird Ihm vorher vermutlich sehr Schlimmes widerfahren sein - kam die Straße herunter. Der Herr Elefantenwärter auf dem Rücken des Elefanten schrie aus Leibeskräften, daß man Ihm aus dem Weg gehen solle und Er die Kontrolle verloren habe, usw. Aber jener Mann blieb auf der Straße stehen und wurde schließlich niedergetrampelt. Ein Freund fragte Ihn danach, wieso Er nicht aus dem Weg gegangen sei,wo Er doch gesehen und gesagt bekommen habe welche Gefahr bestand. Der Mann erwiderte, daß doch Gott in allen Wesen sei und er geglaubt habe, daß der Gott im Elefanten ihn, wegen dieses Glaubens, gewißlich verschonen würde. Da sagte der Freund jenes Mannes: "Aber wieso hast Du den Gott in jenem Elefantenwärter überhört, der da rief, daß man aus dem Weg gehen solle? Jener Mann hatte die Liebe im Verstand - jene Liebe die sich im Verstandhaben nunmal auch ausdrückt - nicht ausreichend kultiviert bzw nicht erkannt, gewußt gehabt....). Man lasse gute Gedanken vorherrschen.

Es ist gut möglich, daß man für ein paar Cent eine Kopie der Bhagavad Gita erwerben kann; die Bhagavad Gita enthält die Philosophie der Befreiung und dennoch können das innere Wesen, die Wahrheit sowie das Wissen der Bhagavad Gita nicht für Millionen von Euros erlangt werden. Jene Wahrheit und jenes Wissen sind nur verfügbar, wenn man die "3-fache Arbeit" praktiziert/macht. Die erste sind Vertrauen, Glaube. Mit Glauben sollte man sich vorbereiten und die Arbeit, im Dienst am Absoluten,  anpacken. Die zweite ist die Ernsthaftigkeit  mit der man sich  der Arbeit oder auch dem Wissen, die/das einem gegeben wird, widmet und daß man mit Ernsthaftigkeit es zu begreifen versucht und das Ganze immer wieder in die Tat umsetzt. Das dritte ist die Disziplin, um Kontrolle über die Sinne und die geistigen Aktivitäten zu erlangen. Kontrolle über die Sinne und die geistigen Aktivitäten haben grundlegende Bedeutung, da ansonsten der/die SchülerIn oder auch AnhängerIn zu gegebener Zeit aufgeben.

Man lasse durch die eigenen wohltätig-hilfreichen und heiligen Bemühungen die eigene Fülle die Fülle des Param-Atman sehen und  man lasse die Übung, den Übenden und das Objekt der Übung in einer einzigen Einheit zusammenkommen, "verschmelzen". Dann verschwindet die Welt als solche und der Param-Atman nimmt deren Platz ein.



Wahre Freiheit

Jemand der einen kleinen Staat besitzt, fühlt sich freier wenn Er einen größeren erwirbt, da er/sie dann auf mehr Resourcen Einfluß nehmen oder auch zugreifen kann, als Er es zuvor konnte. Aber das ist nicht wahre Freiheit. Wahre Freiheit wird erlangt durch die Verwirklichung dessen was Wahrheit, Bewußtsein und Glückseligkeit ist (Anmerkung des Übersetzers: vgl  Shankara, "Sat Chit Ananada") und wodurch man an nichts mehr hängt/keiner Sache zugeteilt ist bzw  auch nicht - mit was auch immer - in Verbindung gebracht wird. Jenes ist wahre Freiheit.

Der Geist ist niemals mit irgendwas zufrieden was er hat (...im Bereich der geistigen  Aktivitäten gibt man sich nie mit irgendwas Erreichtem zufrieden...) und wünscht sich immer noch etwas ganz Anderes. (Anmerkung des Übersetzers: o) Allgemein sei vorausgeschickt: Wenn man irgendjemand einen Dollar schenkt und frägt, was Er für das Sinnvollste hielte, wenn Er irgendeine x-beliebige Summe Geldes hätte, so wäre die Anwort, daß ein Anlegen der Summe, aufdaß mindestens 1 Dollar mehr herauskomme, das Beste wäre und das zu Empfehlende sei. Gemäß des Gesetzes der vollständigen Induktion der Mathematik  - Peano's Axiom Nr. 5 bzgl der natürlichen Zahlen - möchte so ein Mensch dann aber abzählbar unendlich viel Geld und nie wäre er/sie mit irgendeiner erreichten konkreten Summe zufrieden. Andererseits ist unendlich viel Geld nirgendwo auf Erden möglich; selbst zum Hinschreiben jener Summe täte die Erdoberfläche nicht genügen und zum Lagern von so viel Geld wäre auch nicht genügend Platz.
Ähnlich ist es ja angeblich mit der Bürokratie: Bürokratie schafft stets neue, mehr Bürokratie.                                                                                                                            Michael Weinless von der "Maharishi International University" drückte das anhand von Kurt Gödel's Beweis, wonach es selbst über die natürliche Zahlen unendlich viele mathematisch für sinnvoll und wünschenswert zu erachtende "mathematische Sätze" (vgl zB den Satz über Möglichkeit jede natürliche Zahl als Produkt von Primzahlen darstellen zu können, wobei die Zerlegung bis auf die Reihenfolge der Faktoren eindeutig ist) gebe, aus. Allerdings wurde versäumt, daß zB auf jenen seltsamen Video-Kurs der "Wissenschaft der kreativen Intelligenz" anzuwenden, wo Mr. Mahesh - sehr am Anfang - das grundlegend falsche Argument gebrauchte: "Weil man unendlich viele Gedanken tagtäglich habe, müsse die Quelle der Gedanken unendlich sein". Man könnte allenfalls argumentieren, daß wenn jemand doch von "unendlich viel Geld" oder auch "unendlich viel mathematische Lehrsätze" odgl "träumt", er dann offenbar selber an seine eigene Unendlichkeit und insofern Unsterblichkeit glaube. Im christlichen Bereich - ich kann nur für die r.-kath. Kirche das so einigermaßen korrekt wiedergeben - wird an solcher Stelle aber darauf hingewiesen, daß das auf Erden nunmal nicht zu haben sei und daß "wir alle mal sterben werden" und man sich sinnvollerweise auch mit Tod, Gott udgl befassen sollte. Der andere Ansatz ist eben, die Suche nach der eigentlichen Quelle jenes Glaubens an "Unendlichkeit"  per Meditation und Anwendung von Viveka, dh unterscheidendem Denkvermögen, dh dem festen Entschluß sich keiner Täuschung hingeben, keiner Täuschung erliegen zu wollen.

a) Zweifelsohne ist völlige Ruhe, wie es Swami Shantanda Saraswati ja als Ziel bzw Sinn&Zweck von Meditation nannte, solcherart, daß sie unteilbar ist und nähme man unendlich viel von ihr fort, bliebe unendlich viel über. Das ist aber gar nicht so leicht zu begründen. Na klar, wenn man davon ausgeht, daß man jene Ruhe selber in Wahrheit ist, so geht es für einen selber durchaus: Man habe also Ruhe in sich. Nähme man Ruhe weg, hätte man sie  immer noch in Händen sozusagen, dh man hätte immer noch Ruhe. Angenommen das wäre n-mal so "gut" gegangen und man hätte immer noch Ruhe, so würde es nocheinmal möglich sein, da man schlimmstenfalls dann die Ruhe ja in den eigenen "Händen" hätte, da man sie ja selber wegnehmen wollte und also wäre es n+1-mal möglich gewesen ohne daß man ohne Ruhe wäre. Aber da hat man natürlich vorausgesetzt, daß man jene Ruhe selber ist und die Ruhe deshalb nicht verloren gehen kann, weil man selber Ruhe wegzunehmen versucht hätte und sie dann aber immer noch hätte. So ganz überzeugt mich das aber nicht. Was zeigt diese Überlegung eigentlich? Wenn jemand die Ruhe selber geworden ist/wäre, so könnte Er selber die Ruhe aber nicht mehr verlieren; Entweder bliebe Ruhe oder aber Er hätte sie sozusagen in Händen und allenfalls vergessen, sie zu haben. Die Überlegung zeigt, daß man nie endend Ruhe haben würde und insofern jenseits des Bereichs des Karmas, der Handlungen angekommen wäre und aufgrund von Einsicht/Erkenntnis, durch eigenes Tun diesen Zustand der "Karmalosigkeit", des Lebens aus und in Ruhe nicht mehr würde verlieren können, weil man die Ruhe nicht mehr verlieren kann und Ruhe ist nunmal "Karmalosigkeit". Zweifelsohne ist die Idee "Jemand ist die Ruhe selber" nicht wesensfremd zum abendländischen Kulturkreis, da jenes "jemand ist die Ruhe selber" hierzulande ein gebräuchlicher Ausdruck und in gewisser Weise ein sehr hohes, zeitloses Ideal, das zu realsisieren es jedenfalls wert sein würde, traditionellerweise ist. Christentum fühlt sich davon offenbar nicht angegriffen und akzeptiert es als etwas was "jenseits von Religion" ist und zu respektieren ist.

Was wäre mit Ruhe weggeben? Könnte die Ruhe dann "leer" werden? Da wäre antwortbar, daß jeder ja schließlich die Ruhe in sich selber finden sollte können und das vorherige, erste Argument könnte jenen selber überzeugen. Jeder muß halt die Ruhe in sich selber finden und jeder Vorgang des Nehmenwollens odgl wäre etwas, was - als sehr grobe Aktivität nochdazu -  wesensfremd zu Ruhe ist und insofern nie&nimmer würde ans Ziel führen können. Ebenso wäre es wesenfremd zu "Ruhe", zu versuchen sich selber Ruhe zu nehmen und an jemand anders zu geben. Ruhe zu transferieren wäre ein Ruhe bewegen und das wäre Unruhe und allenfalls Unruhe wäre also am Ende angekommen; es ginge also gar nicht. Hier spielt dann wohl der Unterschied von "Atman" und "Paramatman" herein bzw zeigt sich.

b) Es ist da die Frage, ob man Ruhe überhaupt je nehmen könnte: Es scheint eher so zu sein, daß das grundsätzlich unmöglich ist, da jeglicher Vorgang des "Nehmens" ja Unruhe ist und Ruhe nicht erreichen kann können. Das scheint dieselbe Situation zu sein, wie in der Physik, wo man zum Ergebnis kam, daß der absolute Nullpunkt, also völlige Ruhe unerreichbar sind für die Physik. Die Heisenberg'schen Unschärferelation besagt, daß das Produkt aus  der Schwankung des Ortes und der Schwankung des Impulses stets größer als 1/2 mal "h-quer" ist und jedenfalls größer als Null. Wäre also der Ort exakt erreichbar, so wäre jenes Produkt aber 0, was doch unmöglich ist bzw der Impuls müßte dann - was wieder mit Standard-Analysis nicht verträglich wäre - "irgendwie irgendsowas" wie unendlich sein, was so mathematisch unhaltbar wäre. Überhaupt hat die Quantenmechanik das Problem, daß sie sich auch als "Statistik" begreift und von Aufenthaltswahrscheinlichkeiten, Schwankung, Erwartungswert & co spricht. Allerdings kann man in der Potenzmenge des 3-dimensionalen euklidischen Raum überhaupt gar kein Wahrscheinlichkeitsmaß definieren; es gibt schlichtweg keines und das wurde längst exakt bewiesen und zB von Prof Lammel an der TU-München wurde jener Beweis auch mal vorgetragen. Insofern erklärt die Physik - ohne jeglichen Beweises bzw Begründetheitsversuche durch Experimente - durch jene "Darstellungen", daß die Welt der Phänomene auch mit "viel weniger" als der Potenzmenge des 3-dimensionalen (oder gar 4-dimensionalen, etc) reellen euklidischen Raumens beschreibbar wäre. Um mit einem Wahrscheinlichskeitsmaß "messen" zu können, opfert die Physik  also die Möglichkeit, daß es Ereignisse geben könnte, die aber nunmal tatsächlich nur durch einer jener Mengen beschreibbar sein würde, die sie aus der Potenzmenge des 3-dimensionalen (oder auch angesichts Raum-Zeit von Einstein, 4-dimensionalen,...oder auch noch höher dimensional...) nunmal ausgeschlossen haben mußten, um überhaupt von sowas wie einem "Wahrscheinlichskeitsmaß" reden zu können, um sowas überhaupt definiert haben zu können, haben zu können. Würde man also irgendein intelligentes, unsterbliches, liebevolles, freundliches Art "Geistwesen" in seiner "Körperlichkeit" so einer ausgeschlossenen "Menge" zugeordnet seinzsich sekbe so "gestaltet" haben, um nicht einer messbaren Menge zuordenbar sein zu können, so würde es aus der Sicht jener Physik keinem "realen Ereignis" entsprechen, was im Widerspruch zur Wahrheit dann sein würde und eben nur der willkürlichen "Messbarkeits-Forderung" der Physik geschuldet  sein würde. So zeigt sich, daß es sehr wohl möglich ist, daß sich das Leben der Physik entzieht, weil es nicht messbar sein möchte. Man darf dann im Bereich von Spiritualität nicht wieder den Fehler machen "Messbarkeit" zu verlangen/vorrauszusetzen/zu fordern/an den Anfang zu stellen.

Das noch überzeugenste Argument scheint mir zu sein, daß man Ruhe nicht nehmen kann, weil der Nehmvorgang ein "Unruhe-Etwas" ist und "Ruhe" daher gar nicht erreichen kann. Aber auch das Argument a) hat durchaus etwas für sich; im Rahmen jenes Gesamtbildes, wonach jene unendlich tiefe Ruhe jenes SELBST ist und man das selber ist bzw ein Teil davon, ergab die überlegte Argumentation einiges an Sinn.


c) Nunja, man sucht Ruhe in sich und wenn man von jener Ruhe selber was wegnähme bliebe irgendwann Unruhe zurück, so würde man als der/die Genommengehabthabende doch schließlich genau jene Ruhe selber weiterhin haben. Also führt es zu einem Widerspruch, wenn man annimmt, daß das wegnehmen von Ruhe jene wirkliche"Ruhe" je leer machen könnte. Hätte man  durch Meditation wahrheitsgemäß erkennen können, daß im jeweils Anderen auch jene Ruhe ist, so könnte derjenige also selber Ruhe aus sich selber schöpfen und wieso sollte also jenes Reservoir von Ruhe überhaupt jemals leer werden können?

d) Es bliebe die Problemfrage, was wäre, wenn im Anderen jene Ruhe nicht vorhanden wäre und Er also Ruhe aus Anderen schöpfen könnte; könnte dann die Ruhe in einem selber auf jene Weise leergeschöpft werden können?  Ruhe jeneseits aller Aktivitäten und insofern "unmanifest" und kann gar nicht geschöpft werden. - Gemäß der Überlegung b) hätte man nie endende Ruhe und insofern wäre Ruhe an sich unendlich, weil nicht endend, nicht endlich. Insofern ist/wäre das Erlangen von tiefer, grundlegender, gründlicher, wirklicher Ruhe - was Swami Shantanand Saraswati ja als Meditationsziel erklärte/benannte - gleichbedeutend mit dem Erlangen von Unendlichkeit "in" sich selber.

e) Auch im Christentum - es bleibe nicht unerwähnt, daß ich da nur aus den Reihen der r.-kath. Kirchewas sagen kann - wird von einem "Zur Ruhe kommen vor Gott" gesprochen, auch im Neuen Testament der Christen kommt ejnes "kommt zu mir, die Ihr mühseelig und beladen seid, ich werde euch erquicken" vor; allerdings wird das immer als ein Finden von Ruhe, Erholtheit, Abstand  per Suchen in der anderen Person, nämlich Jesus Christus oder aber auch per Suche aus der Kraft Gottes heraus, "Stille, ruhig werden vor Gott" dargestellt und es wird kategorisch geleugnet und ausgeschlossen, daß es ganz natürlicherweise möglich sein würde, jene Ruhe in sich aus der ganz natürlichen Kraft der Ruhe an sich heraus finden zu können. Seltsam, nur weil da jemand lehrte - wie auch Mr. Mahesh; siehe Wissenschaft vom Sein und Kunst des Lebens - daß es um das Erlangen iefer Ruhe in einem selber gehe, fühlten sich da gewisse Vertreter jener christlichen Religion gleich angegriffen und sahen ihre Religion und Einzigartigkeit derselben und insofern Individualität derselben bedroht. Darf man eigentlich noch zur Ruhe kommen oder bedarf es dazu der Sondergenehmigung der Kirchen, CDU, CSU oder auch anderer "christlicher Parteien, Gruppierungen, usw"? Darf man sich dafür täglich 2-mal 1/2 Stunden lang zurückziehen? Dürfte man sich da eines Mantras, das ja auch nichts anderes wäre als ne Art "Musik"  bedienen? (Im übrigen sind die "TM-Mantren", worauf ich noch eingehe, anhand klassicher Schriften ersichtlich, "ohne Bedeutung"  und die TM-Technik, des Umgangs mit Mantren ist nicht die eines "Rezitierens"). Besteht da "Gefahr" für Leib und Seele? Offenbar nein! Es besteht allerfalls Gefahr für irrsinnige, kriminelle UnternehmerInnen, die dann nicht  mehr über ihre "MitarbeiterInnen" über 16 Stunden am Tag bzw bis zu deren totaler Erschöpftheit verfügen könnten! Es bestünde allenfalls Gefahr für "Workalkoholismus" udgl! Na klar, fürchten da gewisse Personen um ihre angeblichen "Verdienste", "Profite" udgl, aber jene kann man würdevollerweise bzw darf man würdehalberweise nicht auch noch dessen betreffs verteidigen!

f) Unendlichkeit hat nunmal so seine eigenen Gesetzmäßigkeiten und schon für die unendlich vielen natürlichen Zahlen der Mathematik (also 1,2,3,...) gilt, daß wenn man zB alle gerade Zahlen wegnimmt, man immer noch unendlich viele Zahlen hat. Nachdem es unendlich viel Primzahlen gibt und jedes Produkt einer Primzahl wieder eine natürliche Zahl ergibt ließe sich diese Überlegung weitertreiben. 2, 2*2, 2*2*2, usw bilden unendlich viele natrüliche Zahlen; ebenso erhält man per 3, 3*3, 3*3 *3, usw unendlich viele, von der 2-er-Serie verschiedene natürliche Zahlen; da sich da smit jeder der unendlich vielen Primzahlen so machen läßt gibt es abzählbar viele Möglichkeiten ab zählbar unendlich viele natürliche Zahlen der Menge der natürlichen Zahlen zu entnehmen und selbst dann  wäre diese Menge noch lange nicht "leer", dh die "Leere Menge", da es ja noch all die natürlichen Zahlen gibt, die aus dem Produkt verschiedener, unterschiedlicher Primzahlen bestehen. Abzählbar unendlich viele, von solcher Unendlichkeit wie jener der natürlichen Zahlen träumende, Lebewesen könnten abzählbar unendlich viel der Menge der natürlichen Zahlen für sich haben/entnehmen/beanspruchen und die Menge der natürlichen Zahlen bliebe immer noch abzählbar unendlich "groß". Es bliebe kurz der Beweis dafür, daß die Menge der Primzahlen abzählbar unendlich ist; das geht zB so: es gibt eine erste Primzahl, die Zahl 2. Angenommen es gäbe nur endlich viele Primzahlen, sagen wir mal n Stück, also p1,p2,p3,....pn; dann wäre die Zahl p1*p2*p3*.....pn+ 1 nicht durch 2 teilbar, da bei einer Division durch 2 der Rest 1 bliebe; ebenso ist es wenn man sie durch 3, 5,7,...usw usf zu teilen versucht; stets bliebe als Rest die Zahl 1 übrig. Also müßte diese Zahl p1*p2*p3*...*pn+1 entweder selber eine Primzahl sein oder aber es gibt zwischen der Primzahl pn und der konstruierten Zahl p1*p2*p3*...*pn+1 mindestens 2 weitere Primzahlen pk und pl sodaß pk*pl = p1*p2*p3*...*pn+1 wahr wäre. Na klar könnte die Zahl p1*p2*p3...*pn+1 auch das Produkt von mehr als 2 solchen weiteren Primzahlen, die alle zwischen pn und p1*p2*p3*...*pn+1 lägen, sein. Jedenfalls gäbe es also mindestens 1 weitere Primzahl, die größer als pn wäre und insofern gibt es keine größte Primzahl und daher abzählbar unendlich viele oder aber genauer argumentiert: Zur Anzahl der Primzahlen gehört die Zahl 1, wegen 2 ist Primzahl  und aus der Annahme , daß es n Primzahlen gäbe, dh daß n Teil jener Anzahlenmenge der Primzahlen wäre konnte geschlußfolgert werden, daß es dann aber mindestens n+1 Primzahlen gäbe und also auch die Zahl n+1 Teil jener Anzahlenmenge der Primzahlen  wäre und damit gilt dann nach dem Axiom Nr. V des Peano, dem Gesetz der "vollständigen Induktion", daß die Menbge der Anzahlen der Primzahlen die Menge der natürlichen Zahlen selber ist und damit abzäühlbar unendlich. Damit wurde bewiesen, daß es abzählbar unendlich viele Primzahlen gibt und damit ist obiger Gedankengang vollständig als schlüssig gezeigt worden.  Insofern könnte man die "Quelle" jenes "Traumes" von unendlich viel, jener "Hoffnung auf unendlich viel", auch jener "Hoffnung auf unendlich viel, unendlich viele Jahre umfassendes, ewiges langes Leben" als "kann nicht endlich" sein bezeichnen. Aber die Anzahl der Träume pro Tag ist deshalb, im Gegensatz zu Mr. Mahesh's Behauptung/Lehrversuch, noch lange nicht unendlich groß. Mr. Mahesh  benutzte das, was Er vorgab "begründen" zu wollen bereits für seine "Begründung".... und verstieß damit gegen eines jener Prinzipien von Nyaya, jenem ersten System indischer Philosophie, welches Er in seiner Erstausgabe "seiner" Übersetzung und seines Kommentars zu den ersten 6 Kapiteln der Bhagvad Gita im Anhang - das durchaus sehr interessanter und ansprechender Art&Weise dort dargestellt wurde - dem/der LeserIn mitgab.)

Abschlußbemerkung: In vielen Bereichen läßt sich das Phänomen vom Traum von "unendlich viel" als allbekanntes Phänomen finden und präzise darlegen; es findet sich insbesondere auch im Bereich der Vergüngungen.)


Während ein Armer die Reichen um ihren Komfort beneidet und auch reich sein will, ist ein Reicher ermüdet oder auch zermürbt aufgrund seiner Ängste und beneidet jene, die nichts haben, ihres sorgenfreien, unbekümmerten Schlafes willen. Ein Kranker macht sich Sorgen bezüglich des Gesundwerdens, wodurch er seine Krankheit verschlimmert; ein Gesunder hingegen sorgt sich darum, daß Er krank werden könnte. Die geistigen Aktivitäten haben darüberhinaus eine Tendenz mehr mit der Vergangenheit und Zukunft befaßt zu sein denn mit der Gegenwart. Diese Kombination aus Unzufriedenheit mit der Gegenwart und der nicht-endende Wunsch nach etwas Anderem in der Zukunft verursacht andauerndes Nicht-Glücklichsein. Die Heilung, der Ausweg liegt darin, mit dem Auge wahren Wissens dasselbe in Allem, jenes Gemeinsame in Allem zu sehen und jenes Eine ist Param-Atman. Dann werden die Haltung und Aussicht ausgeglichen und von Einheit getragen, Unruhe macht Beschaulichkeit Platz.


Wahres sich Zurückziehen, wahrer Verzicht

Die Schöpfung ist solcherart, daß alles einen Zweck, eine Absicht hat und seine Funktion erfüllen muß; so muß es im Kreislauf bleiben, es muß genutzt werden. Man gebrauche alles und gebe die Idee auf, daß man Verzicht übt. Man klammere sich an nichts in dieser Schöpfung; jenes kann nur durch diesen beschließenden Verzicht des Aufgebens der Idee, daß man irgendetwas habe erreicht werden; tatsächlich hat man nichts. Alles besteht aus dem Absoluten, alles wird von dem Absoluten durchdrungen; man benützt was immer man braucht und der Rest gehört einfach Ihm. Dies ist wahres Verzichten.

Wahres Wissen wird jedermann verfügbar gemacht und zwar um zu zeigen, daß all diese Schönheit tatsächlich die Schöpfung dessen ist, was auch das eigene SELBST ist. Es steht jedermann frei, sich daran zu erfreuen und jene Glückseeligkeit  zu geben, welche darin besteht einem das zu geben, was man wirklich möchte. Man verhafte sich an nichts, weil die Glückseeligkeit verschwindet sobald man es tut. Die Schöpfung ist vollkommen frei; es gibt keinerlei Bindung. Man kann alles in dieser Schöpfung wertschätzen und glücklich sein. Man muß nicht verhaftet und schlecht d'rauf sein, um zu versuchen frei zu werden/sein. Man ist frei, man ist frei gemacht und ein freier Mensch weiß, daß alle frei sind.

Was wir aufzugeben haben ist der Wunsch, Nutzen aus unseren Handlungen zu ziehen - und nicht die Handlungen selber. Wenn wir die Handlungen aufgäben, aber uns weiter intensiv den Wünschen widmen, ihnen frönen, dann würden wir einfach nur vorgeben, vortäuschen sie aufzugeben . Bevor ein gewöhnlicher weltlicher Mensch eine Handlung unternimmt, versucht er immer erst einzuschätzen welcher Nutzen, welcher Vorteil Ihm daraus erwachsen werde. Aber ein verwirklicher, erleuchteter Mensch begeht Handlung als eine Angelegenheit der Pflicht, ohne Wunsch nach den sich daraus ergebenden Vorteilen.

Wir sollten nicht vergessen, daß wasimmer der Schöpfer der Welt gegeben hat, Er zugunsten der Welt aufgegeben hat. Er macht ín keiner Weise mehr geltend, der Eigentümer davon zu sein. Wir sollten auch die Gewohnheit pflegen, es als sein Geschenk zu gebrauchen und nicht als unsere Eigentum. Diese Grundhaltung wird unsere bösen Tendenzen korrigieren und dann wird die Ausübung von Hingabe oder auch Meditation Fürchte bringen.

Etwas sich Unterstellthaben, Verhaftetsein bedeutet, etwas als unser Eigentum, Teil von uns zu betrachten, was in Wirklichkeit Gott gehört, Teil von Ihm ist: Unser Körper, unser Haus, unser Wohlstand, unsere Söhne, usw. Indem man diese Gefühl aufgibt, wird man all seine Schwierigkeiten, seinen Ärger  los. Man betrachte die Welt um einen herum nicht als fadenscheinig, dürftig, belanglos. Es ist eher das eigene Gefühl des "Daran-Anhängens" welches belanglos, fadenscheinig ist. Alles was um einen herum geschieht ist so wie es ist. Was daran falsch ist, hängt von der eigenen Einstellung ab. Könnte man seinen Standpunkt, die eigene Einsichtigkeit dazu ändern, würde man damit glücklich sein.

Wir müssen die Idee mit uns herumtragen, daß wir nichts besitzen. Alles wurde jetzt das Eigentum Gottes; wir gebrauchen alles mit seiner Zustimmung und nicht als die Eigentümer. Dies hilft bei der Überwindung der individuellen Egoismen - dann entfaltet sich die reine Verwirklichung des SELBST.

Aufgeben kann jederzeit und unter allen Umständen, in allen Situationen mental und intellektuell vollzogen werden. Es liegt darin keine Frage von heute oder auch morgen; auch nicht von 1 oder auch 2 Tagen pro Woche. Es geht darum - und das gilt es zu üben - es für alle Zeit aufzugeben. Man muß den Körper, den Geist (den Bereich der geistigen Aktivitäten) und den Intellekt als etwas betrachten, was stets zum Param-Atman gehört und was darüberhinaus eine Spende oder auch Opfergabe  an Param-Atman ist. Das ist es, was aufgeben, verzichten heißt.

(Anm. des Übersetzters: Es wäre falsch aus obigen Zeilen zu "schlußfolgern", daß man dann ja den Verbrechen etc frönen dürfe, es nur darum gehe/es genüge eine gewisse Geisteshaltung einzunehmen und dann ein Verbrechen plötzlich kein Verbrechen mit all den Konsequenzen für solche TäterInnen dann mehr wäre. Die Gesetze sind nunmal eben auch so wie sie sind und Swami Shantanda Saraswati sprach ja von "Könnte man seinen Standpunkt, die eigene Einsichtigkeit dazu ändern, würde man damit glücklich sein".)


Tod:

Die folgenden Lehren aus der Bhagavad Gita drücken aus, wie man mit dem Tod umgehen kann/sollte: (1) die Vergangenheit vergessen. Man ängstige sich auch nicht vor der Zukunft. Die Gegenwart Param-Atman widmen. Ein Anhänger, ein Verehrer des Param-Atman vergeht niemals; (2) zugunsten zweier halbstündlicher Meditations-Ausübungen täglich, alle Pflichten und Verpflichtungen ruhen/auf sich beruhen lassen; man gibt sich ganz und gar dem alleinigen sich Kümmern um und Bewahren des Param-Atman hin. Er/es wird einen von allen bösen Folgen, Konsequenzen bewahren und darin läge dann seinerseits das Ende all der eigenen Sorgen. (3) Jemand der Param-Atman in jedermann und allem wahrnimmt/erkennt/sieht - für den wird Param-Atman niemals fremd,unbekannt oder auch unbedeutend und umgekehrt wird  Er dem Param-Atman niemals fremd oder auch bedeutungslos.

Wir haben Angst vor dem Tod weil wir, unter dem Einfluß von Maya (Illusion, Täuschung, Irrtum) , unser SELBT vergessen haben. Und es ist jenes Vergessen des göttlichen (wahren, ewig reinen, edlen) SELBST, das uns all die Mühen, all das Durcheinander und all die Beschwernisse verursacht, denen wir begegnen bzw denen wir ausgesetzt sind/werden. Gott ist nicht der Verursacher all unserer Mühen, unseres Durcheinanders, unserer Beschwernisse, unserer Probleme.

Nach konstant fortgesetzter, durchgehaltener Meditationspraxis und Arbeit an uns selbst, verwirklicht der Suchende, so Strebende, daß ein Mensch nicht nur Fleisch und Knochen ist: Er hat eine Seele (Anm. des Übersetzteres: Noch im Mittelalter wurde im abendländischen Europa geleugnet, daß Frauen eine Seele hätten! In Bezug auf Tiere, Natur, Pflanzen ist das leider immer noch so; im Vergleich dazu lese man etwa im Yogavasishta Rihsi Vasishta's Lehr-Geschichte über die unsterbliche Krähe Busunda.) , er hat Bewußtsein und er hat Glückseeligkeit. Wenn man das in seiner Fülle realisiert hat, wird alles für einen problemlos, einfach. Wasimmer man dann tut, die Art wie man sich bewegt, die Art und Weise wie man spricht spiegelt die Würde des Atman wieder, ist Ausdruck von Atman, welches/welcher reines Bewußtsein und reine Glückseeligkeit ist.

In einer der Schriften heißt es: "Dieser Körper ist nur Fleisch und Knochen; höre auf damit identifiziert zu sein, dem zugeordnet zu sein." Man ordne die eigene Zugeordnetheit um, hin zu  Atman. Insofern Atman ein Teil von Param-Atman ist, gibt es zwischen beiden keinen Wesensunterschied, besteht zwischen beiden keine Trennung. Beide sind in der Lage, Gebundenheit an das Weltliche zu überwinden.

Indem sie Teil des Absoluten sind, sind Individuen grundsätzlich völlig Wissen und vollkommene Freude. Hingabe an Gott beseitigt, führt zur Überwindung von Illusion, Täuschung. Dann dämmert wahres Wissen und wir erkennen, daß auf uns kein Tod zukommt, daß uns kein Wissen zwingend verborgen bleiben muß und daß die allergrößte Freude allezeit mit uns ist.


Die Gegenwart:

Es gibt einen Sanskrit-Vers in welchem es wie folgt heißt: "Das Absolute ist hier in der Gegenwart. Sehe es, erfreue Dich daran und kommuniziere mit Ihm und belaste deinen Kopf weder mit der Vergangenheit noch der Zukunft." Man kann das vergangene Leben nicht zurückholen und man kann sich die Zukunft nicht so schneidern wie man sie gerne hätte. Beide sind jenseits der Kontrolle durch den Einzelnen und also sollten wird unseren Kopf am Allerwenigsten mit der Vergangenheit und Zukunft belasten. Mit der Erinnerung an das Absolute sollten wir versuchen, mit all den herrlichen Dingen, die das Absolute im gegenwärtigen Augenblick bietet, von der Gegenwart Gebrauch zu machen.
Die Gegenwart ist stets erleuchtet, da sie die Gegenwart des Absoluten ist. Es gibt in der Gegenwart nichts worüber man sich sorgen oder was man fürchten müßte.

Vergangenheit und Zukunft sind sehr dunkel und es ist dort wo die Ängste sind; desweiteren sind ist es nur eine gewisse Art von Ängsten, die das Individuum in die Vergangenheit oder auch Zukunft ziehen. Wennnimmer man feststellt, daß man in Richtung der Dunkelheit der Vergangenheit oder auch Zukunft unterwegs ist, komme man in das Licht des Tages - das Licht der Gegenwart.

Es zeigt sich anhand der Schriften, daß sich ein weiser Mensch -...in gewisser Weise ...- wie ein Kind benimmt; damit ist nicht gemeint, daß seine Handlungen kindisch wären, sondern daß aufgrund seiner Weisheit sein Leben aus der Gegenwart gelebt wird. Ein Kind wird weder von der Vergangenheit belästigt, noch kümmert es sich um die Zukunft. Ein weiser Mensch, der sich wie ein Kind benimmt ist immer von Glückseeligkeit erfüllt. Er wird nicht beeinflußt von den Taten in der Vergangenheit oder Erwartungen bezüglich der Zukunft. Er ist immer in Glückseeligkeit und frei.


(Anm. des Übersetzters: In den Patanajali-Yogasutren gibt es einen Vers, indem es darum geht "Sanyama" auf die zeitliche Reihenfolge von Geschehnissen anzuwenden", um dies oder auch jenes zu erreichen. Insofern ist es offensichtlich, daß die Beschäftigung mit der Vergangenheit, wie es ja auch von Kriminalpolizei usw geschieht, im Leben durchaus auch seine - sogar tiefere - Bedeutung hat. Dennoch ist es offensichtlich richtig was Swami Shantanand Saraswati zum Ausdruck bringt, nämlich daß jenes "Absolute" im "Augenblick", in der unmittelbaren Gegenwart anwesend ist und da ja - wegen der infinitesimalen Kürze des Augenblicks der Gegenwart und der Langsamkeit eines Menschen - sonst nichts da sein kann, weil weder etwas andauert noch etwas neues schon entstanden sein kann, ist da eben jenes "Absolute" anzuztreffen. Johann Wolfgang von Goethe brachte das mal zum Ausdruck "Verweile Augenblick du bist so schön", dh auch Goethe schrieb von der Glückseeligkeit und der Freiheit, die der puren Gegenwart innewohnt. Auch Prof. Dr. Konrad Lorenz berichtete in einem seiner Bücher, wie bzw daß Er zusammen mit seinem Hund in den Donauauen immer wieder jenen ewigen Augenblick, jene Zeitlosigkeit, Glückseeligkeit und Freiheit des Augenblicks erlebte.)





Dunkelheit und Licht, Licht und Schatten


Es kann keine Dunkeltheit ohne Licht geben. Man habe keine Angst vor Dunkelheit, es gibt jenseits davon Licht. Wenn völlige Dunkelheit da ist, dann wird sich selbst ein kleines Licht verbreiten und verbreiten können. Aber wenn der Platz völlig erhellt ist, erscheint das kleine Licht sher unbedeutsam zu sein, fast vernachlässigbar. Wenn man das Gefühl hat, in Dunkelheit verloren zu sein, ruft das Angst hervor; aber man habe keine Angst, denn jenseits davon scheint Licht. Habe volles Vertrauen darin, daß es Licht gibt und daß es deine Angst vollständig beseitigen wird.

Wenn wir einige Zeit dafür aufwenden, heilige Bücher zu lesen, einige Zeit benutzen um über Param-Atman  nachzudenken, dann reift unsere Weisheit heran; Dunkelheit versetzt uns nicht mehr in Angst&Schrecken und wir erlangen höchstes Glücklichsein. Nicht nur das, wir beginnen Glücklichsein auszustrahlen, was seinerseits sowohl unsere Umgebung als auch  jene um uns herum beeinflußt.



Fazit:

Schlußendlich liegt es beim Einzelnen, sich ein-für-allemal für Liebe und nichts als Wahrheit zu entscheiden und den Rest weg zu lassen. Und man muß dann dabei bleiben. Dann und nur dann ist Transformation möglich.


(Anmerkung 1 des Übersetzters: Für die Übersetzung benutzte ich zur Ergänzung dessen was ich in der Schule erlernte, Online-Übersetzer, etwa:
https://de.langenscheidt.com/deutsch-englisch
aber auch
https://de.pons.com/%C3%BCbersetzung/deutsch-englisch

beide Links wurden am 4.10.2017 geprüft.

Anmerkung 2 des Übersetzers: Swami Shanatand Saraswati befleissigte sich einer sehr gut verständlichen Sprache, er benutzte kurze Sätze, einfache Worte und seine Ausführungen sind insofern ein großartiges Kunstwerk; mir ist es sicherlich nicht so gut gelungen, diese einfachen, kurzen Sätze wiederzugeben; später dann vielleicht mal.

Anmerkung 3 des Übersetzters. Ich meine, daß seine Darlegungen präziser und dennoch einfacher sind als analoge Darlegungen des Mr. Mahesh.                                                    Dennoch, wer jene "Transzendentale Meditation" , wie sie Mr. Mahesh - wie er sagt         gelehrt bekommen von Swami Brahmanda Saraswati - jahrzehntelang lehrte, mal gelernt und ausgeübt hat, der kann die große Ähnlichkeit in der Darstellung kaum übersehen.      Nahezu nahtlos kann man ebenso gut die Ausführungen/Anweisungen von Swami            Shantand Saraswati beachten; allerdings kann man nicht wissen, welche Mantren Swami Shantanand Saraswati zu vergeben pflegte, welches Mantra er einem gegeben haben        würde.)



c) Eine umfassendere Korrespondenz mit Swami Shantanand Saraswati, allerdings auf Englisch, findet man zB bei:

https://www.ouspenskytoday.org/wp/the-record-of-shankaracharya-audiences/

A RECORD OF AUDIENCES & CORRESPONDENCE
WITH HIS HOLINESS SHANTANANDA SARASWATI
SHANKARACHARYA OF JYOTISH PEETH
1960 – 1993

All Rights Reserved
FOR PRIVATE STUDY ONLY

Indexes: © Jenny Beal 2016



d) Im Buch "Celebrating the Dawn" von Robert M. Oates, Jr., G.P. Putnam's Sons, New York, ISBN 0-399-11815-2, berichtet Mr. Oates auf den Seiten 79 bis 83 von Vorträgen, die Shankaracharya Swami Shantanand Saraswati - im Rahmen jener Aktion "Celebrating the Dawn" des Mr. Mahesh - hielt; leider ist der Wortlaut jener Reden im  Buch nicht enthalten. Der Autor, Hr. Oates, war gemäß seiner Schilderungen  auf den Seiten 21 bis 31in seinem Buch auf demselben TM-Lehrerausbildungskurs in Playa La Antilla (Spanien) wie ich und ist insofern auch ein Zeuge für die Richtigkeit meiner Wiedergaben von Aussagen des Mr. Mahesh im Rahmen jenes Kurses. Mr. Mahesh hielt also durchaus einen gewissen Kontakt zu Shankaracharya Shantananda und ließ ihn offenbar im Rahmen einer seiner Veranstaltungen auch frei zu Wort kommen; leider wurden diese Reden, die es sicherlich auch als Video und mit englischer Übersetzung gibt, nicht allgemein-zugänglich gemacht.






12) Mr. Mahesh Prasad Varma, der von AnhängerInnen als      Maharishi Mahesh Yogi bezeichnet wurde.


Bei https://www.biography.com/people/maharishi-mahesh-yogi (Link vom 4.9.2018) heißt es ua, er sei zwischen 1911 und 1918 in dem kleinen Dorf Chichi  unweit Jabalpur in Zentralindien geboren worden; allerdings nennen die meisten offiziellen Quellen den 12.Januar 1917 als sein Geburtsdatum. In der Jugendzeit habe er in Fabriken gearbeitet und körperliche Arbeiten verrichtet.


Bevor Er zu Swami Brahmanda Saraswati als "brahmachary" kam, beendete er ein Physik-Studium in Indien; im Internet gehen die Darstellungen bezüglich seines Abschlusses - ob Er mit B.A. oder auch M.A. abschloß - auseinander. Bei https://www.biography.com/people/maharishi-mahesh-yogi (Link vom 4.9.2018) heißt, daß er  von der Universität in Allahabad 1942 einen M.A. in Physik erhalten habe.


Er war - wie auch Shankaracharya Swaroopananda im Interview im Rahmen des Films "David wants to fly" bestätigt/einräumt - bis zu dessen unerwarteten Tod im Jahr 1953 der Privat-Sekretär von Shankaracharya Swami Brahmanda Saraswati, sodaß er ca 10 bis 11 Jahre bei seinem - frei gewählten Guru - verbracht hat.


Nach dem Tod von Swami Brahmanda Saraswati, habe er sich nach Uttar Kashi im Gangestal begeben und nach den Gepflogenheiten der Sadhus dort gelebt. Bei einem älteren Sadhu, mit dem er desöfteren zusammen gesessen und meditiert habe, habe er sich wohl gefühlt, er habe ein gutes Gefühl in Bezug auf ihn gehabt.


Ca 1955 hatte Er sich auf eine Pilgerreise nach Südindien zu einem brühmten Shiva-Tempel  "Rameshvaram", nach Rücksprache mit jenem erfahrenen, älteren Sadhu begeben.

Er befolgte den ersten Rat jenes Sadhus und ging dorthin (...bei Paul Mason kann man eine handschriftliche Postkarte mit Unterschrift von Mr. Mahesh finden, in welcher Er einer wohlhabenden Frau anbot, sie nach Südindien zu begleiten. Nunja, evtl. hatte er sich entschieden gehabt, dorthin zu gehen und jene hatte ihn zuvor mal gebeten gehabt, sie zu begleiten. So verband er dann halt beides miteinander...).

Den zweiten Rat jenes - von Ihm für weise und kompetent gehaltenen - älteren Sadhus, die Welt außerhalb des Gangestals sicherheitshalber als "Welt der Maya, Welt der Täuschung, Illusion, Verführbarkeiten, usw" zu betrachten (...und insbesondere also bei "etwaigen komischen Vorkommnissen" von Missverständnissen udgl auszugehen, um sicher zurückzukehren...) missachtete Er (....als ein Buchhändler, entgegen seines konkrekt - wie Mr. Mahesh berichtete - auszudrücken sich befleissigt gehabt habenden Wunsches, daß Er keine Vorträge halten möchte, anscheinend so  einfach-mir-nichts-dir-nichts Vorträge für Ihn  angesetzt hatte...) und so verwickelte Er sich erst in Vorträgehalten und dann in immer umfassendere, allgemeinere Lehrtätigkeiten. (siehe  Mr Mahesh & TM auf Deutsch).


Ab der späten 50-er Jahre, also so ca ab 1958 n. Chr., begann Mr. Mahesh jene Meditationstechnik zu lehren, die - gemäß seiner Ausführungen - das Wissen von Swami Brahmanda Saraswati, jenem Shankaracharya des Nordens, den Er als Guru Dev bezeichnete und verehrte, gewesen sei. Er habe jene Meditationsmethode einfach als "transzendentale Meditation" (von Ausübenden oftmals kurz als "TM" bezeichnet) bezeichnet. Ein abstraktes Lehrgebäude habe Er nicht gehabt, als Er anfing "TM" zu lehren; er kannte jene Meditationsmethode, grundlegende Auswirkungen im Sinne von Spiritualität.

Nunja, solange Er sich einer grundlegenden Vernünftigkeit im Rahmen seiner "Lehraktivitäten"  befleissigte und bei dem blieb , was Er während jener ca 13 Jahre Swami Brahmanda Saraswati mitbekommen hatte und woran Er sich sicher erinnerte, könnte (...man könnte unter Umständen sogar äußern "sollte es gut gegangen sein"...) das ja gut gegangen sein; leider wurden aber mehr oder weniger, teils auch jüngere Menschen in jenen "Sumpf aus Täuschung" (gebräuchliche, etwas interpretierende Übersetzung für "Maya") hineingezogen, was insbesondere im Zusammenhang mit Minderjährigen selbstverständlich ein erhebliches Konfliktpotential dann mit sich brachte und leider bisweilen nicht ohne schwerwiegende Folgen für die "Opfer" blieb.

Weitergehende Darstellungen insbesondere ad Patanjali Yogasutras, Bhagavad Gita, usw kamen in dem Maße hinzu, als man Ihn danach gefragt habe.

Betreffs der Transzendentalen Medatiation vergleiche man etwa mit "Sayings of Swami Shantanand Saraswati" bzw meiner deutschen  Übersetzung "Swami Shantanand Saraswatis sprach".

Man könnte auch die "112 Wege Shivas" heranziehen und sich fragen inwieweit "TM" etwas mit jenem Weg zu tun hat, der da heißt: "Gerade wenn Du etwas tun willst, verharre" und insofern übt man "TM" morgens (vor dem Alltag) und Abends (vor den Abend-"Tätigkeiten", dem abendlichen Ausruhen, dem "Feierabend") aus; außerdem findet sich bei "Sayings of Swami Shantanand Saraswati" etwas über den Umgang mit Störungen der Meditation in Form von gedanklicher Aktivität wieder und man hat abermals jenes Prinzip in einer praktischen - ein Alltagsleben keinesfalls störende -, zweifelsohne komptenten Anwendung.


Beginnend mit der PhD-Arbeit von Dr. Keith Wallace/USA wurden zahlreiche wissenschaftliche Untersuchungen bzgl "TM" durchgeführt, deren wissenschaftliche Akzeptabilität und Qualität häufig von ProfessorInnen überprüft bzw bestätigt wurde, da es sich nunmal um Diplomarbeiten bzw bei Keith Wallace um die PhD-Arbeit handelte. Dabei konnte es schon mal vorkommen - wie mir widerfahren -, daß eine Diplomarbeit (...genehmigt und "überwacht" von einem Professor für Sportpsychologie und einem Mathematik-Professor für Statistik..) durch Schüsse des Assistenten des Professors für Sportpsychologie in aller letzter Minute vereitelt wurde, was das Ausmaß an Misstrauen, Vorurteilen - zumindest in Deutschland (auch noch nach 1945!) - udgl umreißt.

Solche  statistischen Untersuchungen sind ja soweit wissenschaftlich ok, schwer anzweifelbar und aufgrund der Vielheit sowie ihrer Natur als Doktorarbeiten, Diplomarbeiten, BA- und MA-Arbeiten auch unabhängig und fachlich höchst qualifiziert kritisch "begutachtet" worden.



Allerdings hat man es versäumt eine ebenso wissenschaftlich-anerkennbare, seriöse Strategie im Umgang mit TM und seiner Beziehung um Alltag zu suchen:

"Man füge TM zum Alltag hinzu als wie Zähneputzen und alles wird vonselber besser bzw zu mindestens nicht schlechter" wurde in den TM-Centern gelehrt.

Das war und ist, strategisch betrachtet, keine wissenschaftlich fundierte Strategie und insofern nicht wissenschaftlich anerkennbar. Es ist, wissenschaftlich-betrachtet, Ausdruck und Folge von Hazadeurhaftigkeit, D'raufgängertum.

Wieso? Nunja, Mr. Mahesh lehrte ja auch, daß "TM" im Sinne der Patanjali-Yogasutren so was wäre, wie das Ziehen an dem einen von 8 "Tischbeinen" und beim "Ziehen an dem einen Tischbein" alle anderen auch daherkämen, also ua "ahimsa" (Nicht-Töten), "brahmchary" (Keuscheit, bisweilen als Ehelosigkeit auch übersetzt), "aparigraha" (Nicht-Heftigkeit, Gewaltlosigkeit), was - yogisch und aus der Sicht vieler Menschen und evtl auch der gesamten GöttInneschar an und für sich, isoliert betrachtet - höchst willkommen ist/sein würde. Wenn sich jemand dann an "Ich habe TM dazugefügt wie Zähneputzen und korrekt, regelmäßig, die Anweisungen selbstverständlich beachtend ausgeübt" und  sich dann allerdings plötzlich Zweifeln, einem seelischen Konflikt mit seinem Alltag, seinem Beruf, seinem Job ausgesetzt sieht, so ist das Entstandensein solcher Probleme die Folge und auch Ausdruck der nicht mitgegeben gewesenen seriösen Strategie.

Es ist so wie, wenn jemand voller Freude feststellt, daß statistisch dieses oder auch jenes Geschäftsmodell funktioniere, mit auf dass Sorfältigste wissenschaftlich erforscht gehabt habender statistscher Zuverlässigkeit funktioniere und man es aber versäumte das Restrisiko per einer passenden Versicherung, aber auch Rechtsgutachten abzusichern; dann kann es einem passieren, daß man dennoch pleite geht, in Konflikt mit der Gesellschaft oder auch dem Staat oder auch dem Gesetz gerät.

Insofern müßte man nunmal schon über "gute Lebensführung", "gut-möglich" udgl genauer reden und auf Lebensstile, Berufe usw auf die eine oder auch andere Weise genau genug eingehen.

Wer sich für eine Art von  Lebensweg entschied, wie es Mr. Mahesh mal getan hatte, als Er zu Swami Brahmanda Saraswati ging, der dann schon die Aufgaben des/eines Shankaracharyas von Jothir Math übernommen hatte, dem mag all das egal sein, für den mögen ja all solche Veränderungen seines Denkens, Fühlens, inklusive einem davon Art "Überrollt-"Werden" usw willkommen sein.

Aber wer in einer Gesellschaft lebte und das auch nicht ändern wollte, für den waren und sind solche Konfliktsituationen nicht so ohne Weiteres zu gebrauchen und für solche gilt wohl, daß das vorab geklärt sein müsse, da sonst eben jenes "Restrisko" blieb und wenn sojemand dann, statt in den höchsten Ebenen der Gesellschaft seinem Lern-Vermögen, seinem Können, seinem Plan gemäß anzugelangen, sich in einer geschlossenen Psychiatrie, Ausgrenzung, Verfolgt-,Diffamiert- und mit Lügen-Beworfen-Werden, Verleumdungen ausgesetzt wiederfindet, so mag Er ja immer noch die Korrektheit der TM-Übung anerkennen und sich daran - isoliert - erfreuen, aber es bleibt so jemand ua keine andere Wahl als - und das ist individuell verschieden - festzustellen, daß man brutal betrogen wurde und da jemand statt Yoga zu lehren, nur "Yogische Techniken" im Sinne von "Kriegsführung" gegen einen missbraucht hat, weil er einem vorsätzlich, wider besseren Wissens not-wendige Vorab-Informationen vorenthalten hat.

Es ist etwa vergleichbar zu jenen "Geldberatern"  - durchaus auch "seriöser" Banken -, die gewisse Risiken verschwiegen, um einen "Vertrags-Abschluß" und ihren "Boni" zu erlangen.


Dabei ist dann aber auch der Umgang des, zB deutschen Staates, mit der TM-Scene in jenem Zusammenhang zu kritisieren. Im analogen Fall von Geldbaratungsinstituten, beließ es der deutsche Staat damit, die Problematik zur Kenntnis zu nehmen und per gesetzlicher Vorgaben für solche "Beratungen", Abhilfe zu schaffen sich bemüht zu haben. Im Falle TM-Organisationen und jener , sozusagen, Lebensberatungsoragnisationen, zog man es vor das Kinde mit dem Bade auszuschütten, dh man beschimpfte jene Organisationen als "destruktiv", später als "hochgefährlich". Hier verstieß die Bundesregierung eindeutig gegen "gleiches Recht für Alle", dh das Prinzip der Gleichbehandlung, Wieviele Menschen sterben alljährlich in Kletteranlagen, bei jenem  "Klettern- Trainieren"? Wieviele  holen sich schwere bleibende Schäden? (Dabei sage ich keinesfalls, daß Klettersport Blödsinn sei, denn wenn man als zB Jude, Israelit, Sinti, Roma, Intellektueller zur Zeit des sog. 3.Reichs bzw - besser - zuvor, Klettern erlernt gehabt hätte, hätte man nunmal eine Fluchtchance mehr gehabt. Dabei ist es allerdings richtig, daß Alpenvereinssektionen Mitbürger jüdischen Glaubenbereits ausschlossen hatten, bevor Hitler mit seiner Verfolgung anfing.) Aber Klettern" machte man zum Schulsport; TM - worüber es zahlreiche fundierte wissenschaftliche Studien gab und gibt, wurde und wird diffammiert, diskriminiert und, obwohl es sich doch offenbar um eine Meditationsübung handelt, wird sie als "Sekte" bezeichnet, was ungefähr so absurd und tolldreist ist und war als wie wenn man "Wandern", Bergwandern", "Spazierengehen", "Beten", "Singen", "Chanten","Lesen" , Ansehen von Kunstausstellungen, Museumsbesuch usw als Sekte bezeichnete. Wenn man staatlicherseits sich die Freiheit nähme, darauf hinzuweisen, daß Klettern gefährlicher ist als wie Spazierengehen in öffentlichen Parkanlagen, so würde das - bei entsprechenden faktischen Unterlagen - völlig ok und fair und der Wahrheit entsprechend sein. Wenn man staalicherseits noch dazusagen würde, daß aber auch da was passieren könne, so entspräche es, angesichts von Morden, Vergewaltigungen in öffentlichen Parkanlagen, allerdings auch der Wahrheit.


Im Verlauf der Jahrzehnte bildete Mr. Mahesh Tausende von TM-LehrerInnen aus. Beim Kurs in Playa La Antilla von Anfang März bis Anfang Mai 1973 waren es alleine ca Tausend. 

Der erste TM-Lehrerausbildungskurs fand in Rishikesh statt, nachdem man meinte, daß "downtown Los Angeles" dazu keine so päßliche Örtlichkeit sei. Mr. Mahesh suchte nach einem geeigneten Grundstück, ging mit seinem Suchergebnis zu den Behörden, die dann zu Ihm sagten (so verzählte Mr. Mahesh mal): "Danke. daß Sie für uns ein schönes Grundstück gesucht und gefunden haben; wir werden dort unsere Polizeiakademie hinbauen. Mr. Mahesh, so erzählte er weiter, haben dann gesagt: "Ok, dann bauen wir unsere Akademie dort hinten hin; dort ist nichts als dichter Wald.". Nunja, ohne Rodungen konnte man dann dort aber auch nichts hinbauen und so wirft das ein sehr schlechtes Licht auf Maharishi Mahesh "Yogi"; so nen "richtiger Yogi" war er wohl nicht  (Im folgenden Link heißt es ua: "Im Laufe der Jahrzehnte eroberte sich die Natur das Gelände des Ashrams zurück. Foto: Eran Sandler" und " 2003 wurde der Ashram von der örtlichen Forstbehörde übernommen") und so war das auch seinen Bemühungen abträglich . Da würde es in Californien wohl Grundstücke ohne Vegetation gegeben haben bzw zumindest mit zuverlässig verpflanzbarer Vegetation, sodaß zusammenhängende Brachflächen zum Bebauen verfügbar geworden sein würden. In https://www.indienaktuell.de/magazin/tourismus/beatles-ashram-in-rishikesh-fuer-besucher-eroeffnet-675319 (Link war am 3.2.2019 ok) kann man sich ein Bild davon machen und etwas über die Örtlichkeit als nahe eines Tigerschutzgebiets erfahren. Es heißt auch "Maharishi gab den Ashram einige Jahre nach dem Aufenthalt der Beatles auf.", was ebenfalls von mangelndem Umweltbewußtsein von Mr. Mahesh und seinen "Finanzierern" zeugt. (Es war Hr. Charles Lutes, der Mr. Mahesh klar gemacht hatte, daß er als Einzelperson seine Ziele einer geistigen Erneuerung der Welt niemals würde erreichen können. Darauf verkündete Mr. Mahesh, daß er TM-LehrerInnen ausbilden werde, was dann wiederum zum Bau jenes Ashrams geführt hatte. Wenn man dann noch bedenkt, wie wenig "TM'ler"- zumindest zum Teil; alleine ich kenne 3 TM-Lehrer aus München persönlich, die dort ernsthaft erkrankten: Der eine wäre fast an "Malaria Tropica" gestorben; nen Anderer holte sich "Gelbsucht" und bleibenden Leberschaden; ein Dritter starb in München dann an "Tollwut"; das auch zum Thema "verbesserte Gesundheit durch TM", nunja TM mag ja der Gesundheit dienlich sein; aber die TM-Scene ist dann doch wieder was Anderes. -  dann im Zusammenhang mit Indien auf ihre Gesundheit achteten, zeigt sich ziemlich deutlich welche Schnappsidee jene Ortswahl gewesen war. Nimmt man noch die Fliegerei und die daraus resultierenden Umweltschäden - Treibhauseffekt - hinzu, wird die Schnappsigkeit jener sog. "Entscheidung" überdeutlich.). Daß diese Örtlichkeit im angegeben Link als "Beatles-Ashram" bezeichnet wird, ist reichlich absurd, nachdem es "die Beatles" als Band nicht mehr ´gibt, sie auch niemanden dorthin zu Unterrichtszwecken einluden noch einladen. Man wird Mr. Mahesh nicht gerecht, wenn man ihn ausschließlich auf jene ziemlich kurze Episode als "Guru der Beatles" zu reduzieren versucht und genauso wenig wird man den Beatles gerecht, wenn man sie nur auf  jene doch sehr kurze Episode zu reduzieren versucht. Daß es dem einen oder auch anderen jener Musikband für's Leben anhaltend was geholfen hat, mag ja sein und wäre dann ja auch schön für jene und ihnen selbstverständlich gegönnt.


Mr. Mahesh bemühte sich in Zusammenarbeit mit fachlich qualifizierten TM-Ausübenden um eine "Standardisierung" jener TM-Lehrer-Ausbildungskurse und selbstverständlich auch der angebotenen "TM-Kurse". Der britische Pädagoge Max Flissure leistete dabei sehr viel Arbeit und leitete zB den Kurs in Playa La Antilla von März bis Mai 1973 dann auch selber (Mr. Mahesh kam dann noch die letzten Wochen über hinzu).

Die anfängliche Konzeption von Mr. Mahesh war, daß jene "TM-LehrerInnen" dann in den verschiedenen Teilen der Welt, jeweils in ihrem Heimatland bzw Land in dem sie fest lebten, Lehrzentren gründen und dort jene "TM-Kurse" gemäß der erlernten Art-und-Weise - wie man es ihnen gelehrt hatte sie abzuhalten - anbieten. Dabei war, organisatorisch, anscheinend Shankara das Vorbild. Shankara hatte zu seiner Zeit jener 4 Lehrzentren gegründet und jene Shankaracharya-Tradition hinterlassen; analog sollten Lehrzentren mit qualifizierten TM-LehrerInnen entstehen, wobei Mr. Mahesh klar war, daß jene TM-LehrerInnen erst im Zuge derer eigenen, mit den Jahren zunehmenden, Meditationserfahrung die Lehrinhalte so wirklich richtig begreifen würden. Bis dato sollten sie eben, etwa in Analogie zum phenomenalen Gedächtnis und der Zitierperfektion von Shukadeva, das einfach so lehren, wie man ihnen beigebracht hatte es zu lehren. Dabei berief  sich Mr. Mahesh evtl. auch jene Lehre in der Bhagavad Gita, wonach es auch erfolgreich zum Ziel führe, wenn man richtige, wahre Ratschläge befolgen würde, ohne verstanden zu haben, daß  und warum&wieso sie ans Ziel führen.

Bis zum März 1973 war es Mr. Mahesh gelungen einen durchstrukturierten Kurs zur Ausbildung von TM-LehrerInnen, (u.a.?) unterstützt vom britischen Pädagogen Max Flissure, zustande zu bringen. Damals galt die "TM-Scene" in USA, Deutschland usw als sowas wie gemeinnützig, besonders förderungswürdig und stand - so weit ich das mitbekam - in der sog. "Freien Welt" zumindest nicht auf "Negativlisten". Es war nicht alles perfekt und Etliches würde zu verbessern gewesen sein, aber immerhin.             Papst Paul VI gratulierte mal der "TM-Bewegung" zu ihren Bemühungen um Frieden.



Nachdem es im unmittelbaren Anschluß an einen großen TM-Lehrerausbildungskurs in Äthiopien, 1974, zu einer kommunistischen Machtergreifung gekommen war, sprach Er plötzlich von seltsamen, durch TM-Ausübung nicht mehr verifizierbaren - angeblichen - Auswirkungen von TM:

Auf der Basis einer fragwürdigen US-Statistik sprach  Mr. Mahesh dann von einem angeblichen 1%-Effekt (...wenn man mal an "Swami Shantanad Saraswati sprach" und dem Umgang mit Gedanken während der Meditationssitzungen, den er beschreibt, denkt, so ist es doch offensichtlich, daß durch TM-Ausübung sowas wie der 1%-Effekt nie&nimmer verifiziert werden kann können.

Man kann tiefe Ruhe, Entspannung, Entspannheit, Momente absoluten Bewußtseins udgl per transzendentaler Meditation verifizieren.

Würde man während so einer Meditation aber den Gedanken, die plötzlich Einsicht gehabt haben: "Hoppla, es gibt einen 1%-Effekt", so würde man sich damit nach der Meditation zu befassen gehabt haben und das würde dann aber normale statistische Arbeit sein und zwar Etliches davon, sodaß das nur wenige mathematische SpezialistInnen überhaupt könnten.

Nachdem der 1%-Effekt also  grundsätzlich nicht durch TM-Ausübung verifizierbar ist, verließ Mr. Mahesh damit - leider - die "Wissenschaftlichkeit", die er versprochen gehabt hatte.

TM sollte der jedermann mögliche praktische Teil sein, sozusagen das Experiment, das gewisse Erfahrungen liefert, die es im theoretischen Aspekt - für alle Meditierenden im Maße ihrer Meditationserfahrungen nachvollziehbar - exakt zu beschreiben und zu erklären gegolten hätte, aufdaß zuverlässige Prognosen möglich wären und Interessenten vor Fehlschlüssen, falschen Hoffnungen usw bewahrt sein sollten, war die anfängliche Konzeption (bis eben ca 1975/1976).

Nun sprach Mr. Mahesh plötzlich davon daß "Statistiken" so einen "1%-Effekt bewiesen hätten (obgleich man per Statistik, lt. Prof . Ulrich Kockelkorn und Anderen, nunmal gar nichts "beweisen" kann).


Er übergab außerdem (einerseits wegen extremer Arbeitsüberlastung; man belästigte Ihn teils bis um 4.00  Uhr Morgens mit organisatorischem Kram und andererseits nun auch - anscheinend - aus Prinzip), was nicht grundsätzlich falsch gewesen wäre, die organisatorische Leitung erstmal dem sog. "board of direectors", das dominiert worden war von den US-TM-Organisationen.

Innerhalb weniger Jahre wurde unter dem "Diktat" der US-TM-Organisationen dann etwas, was zunehmend als "Sekte" bezeichnet  wurde.

Später wurde dann, anscheinend durchaus unter seiner "Führung", jene "Weltregierung des Zeitalters der Erleuchtung" daraus gemacht, welche zweifelsohne grundlegend abweicht, von dem was Shankara dereinst der Welt hinterließ.

Zwischendrin gab es mal die sog. "1%-Parteien" und jene traten auch bei Wahlen, zB in Deutschland, mal an; man blieb aber erfolglos.


Es würde überhaupt nicht nötig gewesen sein, den bis dahin eingehaltenen "Kurs" alà "Shankaras Lehrzentren als Vorbild" zu verlassen: Man hätte es so regeln können, daß TM-LehrerInnen grundsätzlich nur in ihren jeweiligen Heimatländern im Rahmen tätig werden dürfen.

Dann würde es ausgeschlossen gewesen sein, daß irgendwelche RevoluzzerInnen TM-LehrerKurse absolvierten, um dann in anderen Ländern vorzutäuschen, jemand initiiert zu haben, nur deshalb mehr oder weniger - angeblich dem Frieden dienen wollend - regelmäßigen Kontakt zu jenen zu pflegen und aber in Wirklichkeit ihre MitstreiterInnen (Mit-TerroristInnen) zu sich beorderten, ihre Kommandostrukturen aufbauten, um dann Revolutionen zu versuchen; das Hauptangriffsziel war dabei das bevölkerungsreiche, großflächige, anscheinend geostrategisch interessant gelegene Indien. Nachdem "TM'ler" als weltfremd galten und auch vom KGB  entsprechend lautstark so "beschimpft" wurden (Siehe Ausführungen von Juri Bezmenow in jenem US-Interview ca 1980; lt. Juri Bezmenow bezeichnete man solche Personen wie Mia Farrow, die Beatles etc als "nützliche Idioten"), erschien das solchen Personen anscheinend zur Tarnung nahezu ideal zu sein (und dazu agierte der KGB anscheinend ja im Hintergrund, indem Er TM verteufelte als völlig weltfremd, idotisch, wahnsinnig, usw. Man sieht daran auch , wem jene aus Deutschland dienten (va Kirchenkreise, aber auch CDU/CSU) - versehentlich oder auch absichtlich, dummer-oder auch grob fahrlässigerweise - die sich der TM-Verteufelung anschlossen.

Aber Mr. Mahesh meinte, daß eine radikale Hinwendung an "Geldadel" das Sicherste wäre, obgleich die Gefahr, die davon ausgeht, offenbar nur die andere Seite der Münze im Vergleich zu einer "kommunistisch-atheistischen Machtergreifung" zu sein scheint. Freilich war es angesichts der Ereignisse von 1974 nicht allzu abwegig, daß die wohl- oder auch nur geldhabenden AnhängerInnen oder auch FreundInnen oder auch GönnerInnen oder auch MäzenInnen des Mr. Mahesh sich da sagten: "Nicht mit uns, so geht das nicht; wir schaufeln uns doch nicht unser eigenes Grab! Entweder wir machen da unsere eigene 'Geldadel'- oder auch einfach nur 'Wohlhabenden'-Organisation auf, oder wir müßten es eben bleiben lassen". Das wäre ja so durchaus  verständlich gewesen.

Allerdings hätte es da tradionellerweise auch die Option der Gründung einer Kultur-Stiftung, etwa vergleichbar zur Umweltstiftung "WWF, Word Wide Fund for Nature" oder auch zur (älteren) Umweltstiftung NABU oä gegeben. Die Analogie zur "Heilsarmee" mag da auch eine Möglichkeit gewesen sein und aus der Sicht der USA mag man sich gefragt haben, ob "Sekte" nicht eine Möglichkeit wäre und welche "Sekte" es denn noch nicht gäbe und so kamen sie evtl auf jenes - viele sicherlich abstoßende, verprellende bzw auch viele vertreibende/vertrieben habende -  Konzept.

Zweifelsohne bedürfe es da aber auch mindestens einer weiteren Organisation in Fortführung der ursprünglichen kostenlosen SRM-Aktivitäten. (Siehe dazu etwa das Buch von Frau Olson, "A hermit in the house"). Es würde zB denkbar sein, daß gut-bürgerliche NormalverdienerInnen in jungen Jahren da TM anfangen, es ein Leben lang praktizierten, eine Ahnung haben von der Vereinbarkeit von TM-Ausübung und Leben in der Gesellschaft (....bzw bisweilen leider auch nur  "wohl-oder-übel ein Leben mit der Gesellschaft"...), dann irgendwann eine eigene Rente sich ersparten/verdienten (.... evtl. - im Hinblick auf ihr Vorhaben - sich um eine eigene Zwischen-Rente für zB von Alter 50 bis 67 oä bemühten zusammen mit einer Zusatzrente für ab 67 dann - weil sich ja früheren Renten-Eintritt sich erspart/verdient habend und die eigentliche Rentenerträge deshalb geringer ausgefallen wären - ....) und dann, finanziell unabhängig geworden, sich frei dem TM-Lehren sowie dem Lehren der wesentlichen theoretischen Aspekte dazu zu widmen die Vorraussetzungen, die Möglichkeit, die Chance, die Gelegenheit dann hätten. Da muß man für TM-Lehren - ..... etwa auch um Shankaracharya (von Dwakara, bisweilen auch in Personalunion als der von Jothir Math anerkannt und als das aufgetreten...) Swami Roopananda gerecht zu werden, der sagt, daß man für das Lehren von Meditation grundsätzlich kein Geld nehmen darf.....; siehe gegen Ende jenes Filmes "David wants to fly", jenem Film von David Sieveking Deutschland/Österreich/Schweiz 2010, das Interview mit Shankaracharya Swaroopananda  - dann ja auch kein Geld nehmen und kann es dem Einzelnen überlassen irgendwann eine Spende an eine, von solchen TM-LehrerInnen gegründete, "Swami-Brahmananda-Saraswati -Stiftung" zu geben, womit man zB passende Lehrgebäude unterhalten würde können, TM-Lehrerausbildungskurse abhalten würde können usw, wobei man  da einfach eine sorgsame Auswahl zu treffen haben würde und in der Lage sein würde. Zur Verdeutlichung eine kleine Anekdote: Ein junger Bergführer machte mal in einem DAV-Kletterzentrum einen Aushang: "Mache Expedition auf den Makalu (8000-er)"; es meldeten sich  ca 200 Personen; der Bergführer sagte mir dann mal, daß davon gerade mal 2-3 überhaupt - vom bergsteigerischen Können etc her - infrage gekommen wäre. Analog muß man sich eben die Personen, die da TM-LehrerInnen werden möchten, genauer ansehen; nicht alle sind nunmal auch geeignet! Wenn man die Geschichte der TM-Scene mal betrachtet, so stellt man fest, daß man mittlerweile längst so ein Team seriöser Erwachsener, nicht "Geld-Adeliger" in vielen Gegenden Deutschlands etc würde haben können; auch passende Gebäude wären längst gemeinsam aus Spenden finanziert worden. Hier steuerte man einfach nicht so recht sinnvoll. Mr. Mahesh war anscheinend zu schwer verletzt worden von der "Revolution in Äthiopien", von der Ermordung des Yogi Tat Wale Baba (siehe etwaYoga Book, Yoga Guru Shri Tat Wale Baba von Vincent J. Daczynski mit deutscher Übersetzung von Andreas und Waltraud Binder;  Yoga Book, Free Yoga Book Yoga Guru Tat Wale Baba, Free ... http://yogiphotos.com/
Free online yoga book: yoga guru Sri Tat Wale Baba, Himalayas yogi, rishi of the Veda. A free online yoga book about a search in secret India, Kapitel 4, "Ein tragischer Tod") und auch anderen Vorkommnissen, die - auch wegen der Existenz der MIU, Maharishi International University - dominante USA-TM-Scene hatte anscheinend nur noch Geld und absurde Geldadel-Fantasien im Kopf, sodaß für TM-Angelegenheit an sich wirklich sehr großer Schaden entstand. Swami Brahmanda Saraswati, dessen Bild Mr. Mahesh stehts bemühte, der in der Puja als der ursprüngliche "TM-Lehrer" bezeichnet wird, war Chef des "Swami Krishnanand Trust", bevor Er dann im Alter von 75 Shankaracharya wurde. Also auch hier hatte er ja eigentlich ein "Vorbild" hinterlassen, wie man sowas macht und das wäre genau eine "Swami Brahmanda Saraswati"-Stiftung gewesen und nicht jene Geldadel-Dauer-Party.


Ab ca 1974/1975 bemühte sich Mr. Mahesh um Erhalt der und einen eigenen Kommentar zu den Veden. Dazu lud Er Brahmarshi Devarat, dessen Sohn und andere Pandits ein, die Veden zwecks Videoaufzeichnung zu rezitieren. Brahmarshi Devarart, der angeblich bereits für Shankaracharya Swami Brahmanda Saraswati die Veden rezitierte, galt als herausragender Pandit, der - als einer von sehr wenigen - alle vier Veden auswendig und rezitieren konnte.

Besser würde es zweifelsohne gewesen sein, wenn Mr. Mahesh erst mal seinen Kommentar zur Bhagavad Gita beendet haben würde. So kam es zu einem "Viel angefangen und nichts zu Ende gebracht, in der Welt herumgeirrt und große Reden geschwungen, teils Freude verbreitet, teils wirklich Geholfenhaben usw  und teils leider aber auch Chaos, Trauer, Misshandlungen, Verfolgungen, Folter hinterlassen habend bzw mit verursacht haben".

Zum Teil hinterließ er nunmal sowas wie "Die Entführung der schönen Helena" durch den Troya-Prinzen Paris. Im TM-Fall war es ua die "Entführung" des Franz Rickinger, eines angehenden "Wissenschaftler-Stars", in die TM-Scene und ähnlich wie es zum Krieg zur Zurückholung von Helena gegen Troya - mit dem bekannten Ende - kam (siehe etwa auch "die Troierinnen des Euripides von Jean Paul Satre"  - läuft (Ende 2017) zur Zeit im Residenz-Theater in München; Die Troerinnen | Residenztheater, https://www.residenztheater.de/inszenierung/die-troerinnen,
Troja ist zerstört – wie Sindschar und Aleppo. Die Troerinnen und ihre Königin Hekuba trauern um die Toten und erwarten ihr Schicksal. Die griechischen.....-),  so wollte es sich eben jene Elterninitiative nicht gefallen lassen, was da geschehen war und es waren zwar nicht "die Griechen", die da dann mithalfen aber einflußreiche, radiakle Kräfte des Staates, aus den Kreisen der Kirchen, der Psychiatrie, der Psychologie und der C-Parteien.(....Allerdings missbillige und missbilligte ich das und es war alles andere als legal, was Pyschiatrie/Amtsgericht/jene "radikalen Kräfte aus jener christlichen Gruppierung/Sekte da in Bezug auch mich unternahmen...; heutzutage geht sowas eben nicht mehr so wie dereinst im antiken Griechenland; außerdem hatte ich mich März/April 1976 längst selber aus jener TM-Scene gelöst/"befreit" und bot im Übrigen Mr. Mahesh eine Chance sich meine Gründe - die auch für Ihn wirklich bedeutsam gewesen wären, da es um jene mutmaßliche, aber begründete linksradikale Missbrauchung der TM-Scene zugunsten von sowas wie jener kommunistischen Machtergrein Äthiopien ging - im persönlichen Gespräch anzuhören und war dazu extra von Bad Zwischenahn im Bus mit zu Mr. Mahesh - nach Seelisberg/Schweiz oder war er damals schon in Vlodropp/Niederlande? Es war mir ja egal geworden, da ich "ausgestiegen" war? - mitgefahren. Aber er ergriff die Chance - leider - nicht. Ich hatte später keine Chance mehr und per Post & co, was ich ja versuchte, war er eh nicht erreichbar.)


Ende Juli 1991 wurde auf  Mr. Mahesh ein Mordanschlag verübt, was der damals behandelnde Arzt Dr. Chopra genauer darstellt.  https://www.huffingtonpost.com/deepak-chopra/the-maharishi-years-the-u_b_86412.html  (Link geprüft am 20.10.2017).   02/13/2008 10:55 am ET Updated Dec 06, 2017
The Maharishi Years - The Untold Story: Recollections of a Former Disciple
By Deepak Chopra
;13.2.2017 10:55, überarbeitet und neu eingestellt am 6. Dezember 2017

(Übersetzung von mir ins Deutsche ist beabsichtigt. Übersetzung begonnen am 29.11.2018) Übersetzung von mir, Franz Rickinger, ins Deutsche:


Die Jahre mit Maharishi - Die bislang nicht erzählte Geschichte: Erinnerungen eines früheren Anhängers

von Deepak Chopra


Am 1. August 1991 wurde mein Buch "perfekte Gesundheit", ein allgemein beliebter, weit verbreiteter, allgemein verständlicher Ratgeber betreffs Ayurveda veröffentlich; das war am Höhepunkt meiner Beteiligung an, meiner Mitarbeit bei Maharishi Mahesh Yogi's Bemühungen. Obwohl ich damals nur weniger als 1 Jahrzehnt lang meditiert hatte,  was wenig war im Vergleich zu Meditierenden, die schon seit den 60-er Jahren dabei waren, war mein Umgang mit bzw meine Beziehung zu Maharishi rasch persönlich geworden. Er fühlte sich wohl in der Umgebung anderer Inder und hegte eine besondere Wertschätzung für ausgebildete Wissenschaftler und Ärzte. Umgekehrt war ich einerseits von Erleuchtung  fasziniert und hegte großes Interesse für den übernatürlichen oder auch unnatürlich hohen Status den  Gurus genießen. Einige Tage vor der Veröffentlichung meines Buches war ich zum Teilnehmen auf einem Meditationskurs in Fairfield/Iowa. Maharishi sollte zu den versammelten Teilnehmern via Telefonverbindung und Lautsprecher sprechen; aber es kam zum verabredeten Zeitpunkt keine Telefonverbindung zustande, sodaß sich die Versammlung auflöste und alle ihrer Wege gingen.

Einige Stunden später, als ich in Meditation war, kam mir ein Bild von Maharishi vor Augen, wie er mit intravenösen Schläuchen in seinem Körper, atmend mittels eines Beatmungsgerätes in einem Krankenhausbett lag. Eilends beendete ich die Meditation und rief meine Eltern in Neu Dehli an. Meine Mutter ging hin und berichtete mir, daß Maharishi sehr krank war. "Sie meinen, daß er vergiftet wurde. Komm schnell", sagte sie. Ich  bat meinen Vater, der Kardiologe war, sprechen zu können. Sie sagte: "Dein Vater ist nicht hier. Er kümmert sich um Maharishi". So begann eine Reise, die mich zum eigentlichen Wesen dessen führte, was ein Guru ist und was von ihm erwartet wird daß er sei. Diese Zwei - das Wesen eines Guru versus das was von Ihm erwartet wird daß er sei - können in unangenehmen, schrillem, krassen Gegensatz zu einander stehen.

Ich verließ in aller Eile Fairfield und begab mich nach Chicago, wo einer wohlhabender Mäzen für mich freundlicherweise ein Flugzeug gechartert hatte. Als ich in Neu Dehli ankam war es nach Mitternacht. Ich fuhr erst nachhause. Mein Vater war nicht da und meine Mutter sagte mir, daß er immer noch bei Maharishi in einem Haus in Golflinks, einem abgeschirmten, privaten Gebiet in der Stadt, sei. Ein Zimmer war in eine Intensivstation umgewandelt worden, die von meinem Vater und anderen Ärzten geleitet wurde. Ich kam in jenem Haus um 2.00 Uhr morgens an und als ich die notdürftig geschaffene Intensivstation betrat, sah ich Maharishi bewußtlos mit 4 Schläuchen und eineme Beatmungsgerät gerade so in einem Bett liegen, wie ich es Intuitiv vorher-gesehen hatte. Mein Vater informierte mich traurig und eingehend auf der Basis, dessen was vorgefallen gewesen zu sein schien, daß Maharishi starke Schmerzen im Unterleib und eine Magenentzündung zusammen mit Nierenversagen, gefolgt von einer Herzattacke erlitten habe, nachdem ein unbekannter "Anhänger" Ihm ein Glass Orangensaft gebracht und er es getrunken hatte. Man vermutete eine Vergiftung.  Im Verlauf der nächsten paar Tage verschlechterte sich Maharishi's Zustand weiter. Die Magen-und Nierenfunktion verschlechterten sich auch weiterhin und sein Herz verbesserte sich nicht. Mein Vater war der Überzeugung, daß Maharishi für eine Behandlung mit Nieren-Dialyse nach England verlegt werden solle. Die TM-Organisation Indiens, die sich um Maharishi's Neffen Prakash und Anand Shrivastava scharte, war nicht davon abzubringen, daß niemand in der TM-Bewegung herausfinden solle, daß Maharishi ernsthaft krank war. Die rationale Überlegung dabei war, daß seine  AnhängerInnen in Panik geraten und das Vertrauen in Ihn oder auch den Glauben an ihn verlieren könnten.

Ich war unschlüssig, weil Maharishi sich lange Zeit als jemand dargestellt hatte, der weit weg war vom typischen Hindu-Guru. Er pochte nicht auf seine eigene Göttlichkeit. Er drückte es stets so aus, daß seine gesamte Karriere, sein gesamter Erfolg das Verdienst seines eigenen Meisters, Guru Dev, sei. Er schien gleichgültig zu sein gegenüber dem Persönlichkeitskult und der Aura von Aberglaube, inklusive der Überzeugung wonach sie perfekte Kontrolle über Geist und Körper hätten sowie das Geheimnis der Unsterblichkeit besäßen. Aber darüberhinaus sei festgestellt, daß Maharishi keine religiöse Figur war. Obschon er Mönchsgelübde abgelegt hatte, brachte er eine Technik in die westliche Welt; nämlich Transzendentale Meditation, welche völlig von sekularem und sogar wissenschaftlichen Charakter war. Ich denke, daß die Erinnerung an Ihn, seine geschichtliche Bedeutung vermutlich darin liegen wird, daß er Menschen des Westens von den gesundheitlichen und geistigen, spirituellen Vorteilen überzeugte, die eine rein mechanische, nicht-religiöse Herangehensweise betreffs Bewußtsein, Zugang zum  Thema Bewußtsein bietet. Es besorgte mich, es bereitete mir Unbehagen , daß seine Krankwerdung unbedingt geheim zu halten sei, um das Bild, jenes Image eines übermenschlichen Wesens zu pflegen, das nicht wie Normal-Sterbliche krank werden könne.

Es gab jedoch eine Person, der zu vertrauen der innere indische Kreis sich entschied. Es war Neil Paterson, ein Kanadier, der von Maharishi ausgewählt worden war, sein oberster Sprecher und defacto Leiter der TM-Bewegung zu sein. Neil und ich flogen nach England und kümmerten uns darum, daß Maharishi in einer Privatklinik in der Harley Straße  aufgenommen werde. Mein Vater und 2 andere Ärzte charterten ein Flugzeug und brachten Maharishi nach London. Ich erinnere mich, wie ich außerhalb der Londoner Herzklinik stand und einen Ambulanzwagen beobachtete, der mit heulender Sirene durch den chaotischen Verkehr steuerte. Noch bevor Er an der Türschwelle des Hospitals angekommen war, sprang einer der begleitenden Ärzte heraus und stürmte mit der Neuigkeit hoch, daß Maharishi plötzlich verstorben war. Ich eilte zum Krankenwagen, nahm Maharishi's Körper - er war zu jenem Zeitpunkt zerbrechlich und leicht - und trug ihn durch den Londoner Verkehr.

Ich legte ihn in den Eingangsbereich des Krankenhauses und rief nach einem Herzspezialisten um Unterstützung. Innerhalb von Minuten war er wiederbelebt und eilends sorgte man für eine Intensivbehandlung mit Beatmungsgerät sowie Herzschrittmacher, der seinen Herzschlag übernahm. Der anwesende Arzt hielt Maharishi für klinisch tot. Mein Vater schlug vor, ihn jedoch solange mit den Maschinen am Leben zu erhalten, bis seine Familie die Zustimmung gegeben habe, die Maschinen abzustellen. Wie das Schicksal oder auch die Gesetze des Lebens es so wollten, informierte uns nach 24 bis 36 Stunden der zuständige Arzt, daß Maharishi dabei war, sich wundersamer Weise zu erholen. Seine Nierenfunktionen kehrten zur Normalität zurück, sein Herz schlug unabhängig vom Schrittmacher und er hatte angefangen eigenständig zu atmen, Innerhalb weniger Tage richtete er sich im Bett auf und trank Milch mit Honig. Der Arzt vermochte diese Erholung nicht zu erklären.; alle in der Klinik, einschließlich seiner Krankenschwestern waren ergriffen und nicht nur wegen der Rückkehr sondern von seiner Anwesenheit, die in jedermann ein Gefühl von Frieden auslöste, der Ihm näher kam.

Lassen Sie mich hier einen Absatz machen, um die komische Nebeneinanderstellung, das seltsame Nebeneinander, das da stattfand, etwas zu überdenken. Ehrlicherweise fühlte ich in der Mitte der Krisensituation, daß ich einen Sinn&Zweck jenseits meinerselbst erfüllte. Eine Reihe von Umständen hatte mich genau zu jenem Moment gebracht, zu welchem jemand da zu sein und einzugreifen gehabt hatte, um Maharishi's Leben zu retten und es war als hätte das Universum beschlossen gehabt, mich zu jenem Augenblick zu bringen. Zu jener Zeit, zeigten sich beide Eigenschaften: Die all-zu-menschlichen, die man in jedem heiligen Menschen findet, aber auch Andere, die man mit Übermenschen in Verbindung bringt. Ich hatte die deutliche, klare Empfindung, an der Grenze zweier Welten zu stehen; oder sollte man sagen zweier Spielarten der menschlichen Zustände? Es war einfach zu glauben, daß andere Anhänger zu anderen Zeiten etwas ganz Ähnliches in der Gegenwart von Jesus oder auch Buddha gefühlt haben mögen.


Maharishi's vollständige Genesung ging langsam voran. Einmal war ein Punkt erreicht worden, an dem uns der Arzt davon in Kenntnis setzte, daß Maharishi eine ernsthafte Blutvergiftung habe und eine Bluttransfusion brauche. Als sie Maharishi's Blutgruppe feststellten und nach einem potentiellen Spender suchten, war ich der einzige, der infrage kam - dies, bestärkte selbstverständlich mein Gefühl eine teilnehmende Person in einem Drama zu sein, das von Kräften außerhalb meiner gestaltet wurde. Als man jedoch Maharishi bezüglich der Situation informierte, lehnte Maharishi es jedoch ab, Blut von mir gespendet zu bekommen; Gründe dafür nannte er keine. Angesichts all dessen was geschehen war, wie er am College Physik studiert hatte und wie sehr  er auf die wissenschaftliche Gültigkeit von TM Wert gelegt hatte, war dies eine verstörende, rätselhafte Stituation. Dann hatte ich plötzlich eine Idee. Er wollte mein Blut nicht, weil er mein Karma nicht wollte. Nunja, ich war Raucher gewesen, hatte mich in Alkohol und Sex verfangen, dem Alkohol und Sex gefrönt und etliche Jahre zuvor sogar mit LSD experimentiert. Ich ging zu Maharishi und konfrontierte ihn mit meiner Idee, meiner Einsicht. Ich fragte ihn, ob er glaube, daß Karma per Blut übertragen werden könne. Er antwortete zögerlich: "Ja, das ist wahr". Ich sagte ihm, daß rote Blutkörperchen keinen Kern haben und deshalb keine DNS darin enthalten sei. Ohne genetische Information würde doch mittels meines Blutes nur das Hämoglobin gegeben werden, das er brauche und zwar ohne Infektion mit "Karma". Zuerst war er misstrauisch; aber ich veranlaßte den Blutspezialisten Ihm zu erklären, daß durch die Transfusion von rotem Blut weder Erinnerung noch irgendeine Information übertragen würden. Allmählich akzeptierte er mein Blut. Als er  wieder zu Kräften gekommen war brachten wir ihn von der Klinik in ein Hotel in London, um die Erholung weiter voranschreiten zu lassen.

Damit fing eine Zeitspanne zunehmender Vertrauthin zwischen uns an. Wir unternahmen lange Spaziergänge im Hyde Park, was sich auf dem Hintergrund der völligen Funkstille gegenüber der TM-Scene, der man mitteilte, daß Maharishi sich dazu entschlossen habe für eine gewisse Zeit sich in Schweigen zu hüllen, komisch anfühlte. Bei einer Gelegenheit lief im Park ein Fremder auf uns zu und fragte: "Bist Du nicht der Guru der Beatles?". Meine Frau Rita, die uns an jenem Tag begleitete, ging rasch dazwischen und sagte: "Er ist mein Schwiegervater. Laß Ihn bitte in Frieden". Damit war uns klar geworden, daß ein weiterer Aufenthalt in London die Gefahr unnötiger Medienaufmerksamkeit barg. Maharishi wurde zu einem Landhaus im Südwesten Englands verlegt, wo ich Stunden damit verbrachte ihn  persönlich zu pflegen. Er benutzte die Gelegenheit, um mir tiefe Einsichten in und Wissen über Vedanta zu vermitteln. Er gab mir auch Fortgeschritten-Meditationstechniken. Diese zwanglosen, lässigen, absichtslosen Wochen und Monate im - abgesehen von den Bediensteten, die das Essen zubereiteten und servierten -  Alleinsein mit Maharishi waren die kostbarsten Tage in meinem Leben. Ich mochte ihn immer mehr und er erweckte in mir eine Liebe, die ich in meinem Leben zuvor noch nie erlebt hatte. Umgekehrt, merkte ich, daß auch er mich zunehmend mochte. Wir debatierten einfach über jedes Thema in der Welt, über Politik (zu welcher er sehr deutliche Aufassungen vertrat), zwischenmenschliche Beziehungen (die seiner Ansicht nach voller Melodramatik waren) bis hin zur Natur von Bewußtsein (seinem Lieblingsthema). Dennoch blieb ich an jener Schwelle zu einem Geietsfrieden zwischen dem unbequemen Widerstreit aus der physischen Fragilität, Schwäche eines alten Mannes, der zu manchen Zeiten unglücklich und besorgt, bekümmert wirkte und einem Guru, dessen Sterblichkeit wie ein widerwilliges Eingestehen einer Inperfektion war.

Alles zusammen gerechnet war Maharishi 1 Jahr lang aus dem Verkehr; wenige aus der TM-Bewegung wußten wo er war und fast keiner wollte einräumen, daß er krank gewesen war. Nachdem er sich vollständig erholt hatte flogen wir ihn mit einem Hubschrauber zurück zum Aufenthaltsort seiner Wahl, was weder in Indien noch in den U.S.A war, sondern der ablegene und unbedeutende Ort Vlodrop in Holland. Unmöglich könnte man all die vielen AnhängerInnen und sogar jene Meditierenden, die das ganz zwanglos, beiläufig oder auch gar unregelmäßig ausüben, jene Gelegenheitsmeditierer aufzählen,  die alles für ein Alleinsein, ein individuelles, persönliches Zusammensein mit Maharishi gegeben hätten. Aufgrund seiner Massen-Anziehungskraft und seiner unbestreitbaren Präsenz, gab es viele, die einen Moment mit Ihm als den wertvollsten Augenblick in deren Leben schätzten und in Ehren hielten, pflegten oder auch gar sich daran klammerten. Ich wurde jedoch zunehmend von Widersprüchlichkeiten gestört, die ich nicht versöhnen, nicht auf die Reihe bringen konnte, aus denen ich keinen Ausweg fand.


Maharishi hat Jahrzehnte damit verbracht um die Welt zu reisen, um TM zu fördern und zu verbreiten; jetzt blieb er fest in Vlodrop und ich bekam, als einer seiner Haupt-Abgesandten eine Prozedur fast ständiger Jet-Reisen. Sein Ziel war ständige Expansion. Osteuropa und der Ex-UDSSR-Block waren für Meditation zugänglich gemacht worden. Analoges geschah allmählich mit der islamischen Welt, die in weiten Teilen langezeit TM Widerstände entgegenbachte weil die Initiationszeremonie ein Bild von Maharishi's Lehrer, sitzend auf einem Altar (Anm. des Übersetzers: Ich wüßte nicht, auf welchem Altar sitzend das sein sollte; für die Initiationen wurde üblicherweise ein Bild benutzt, welches das Problem beinhaltete, daß an einer Stelle jenes altindische Glücksymbol, im Aussehen einem "Hakenkreuz" der Hitler-Terrorismus-NAZI-Bande ähnelnd, zu sehen ist  - siehe zB: http://meditatinghimalayas.blogspot.com/2016/05/guru-dev-shankaracharya-swami.html -

Bild von Swami Brahmanda Saraswati, das üblicherweise bei der der Puja im Rahmen des TM-Lehrens benutzt wird.

  Desweiteren ist der "Aufbau" für so eine "Puja" im zweiten Bild zu sehen; auch das hat mit einem "Altar" nichts zu tun; jeder Arzt legt für eine Operation das "OP-Besteck" wohl-geordnet bereit; SchülerInnen legen sich Stifte, Zirkel, Lineal &co für eine Schulaufgabe oftmals ebenfalls wohl-geordnet bereit, was ebenfalls im Allgemeinen mit einem  Alter nichts gemeinsam hat. Selbstverständlich steht es allen SchülerInnen frei, aus einer Schulaufgabe eine "Prüfung" durch zB Göttin Saraswati zu machen und das Herrichten von Zirkel, Lineal, Stiften, Radiergummi & co als "Opfer-Vorbereitung" zu verstehen und den erreichten zustand als "Altar zur Göttin Saraswati" zu interpretieren. Aber das hat mit "TM" an sich nichts zu tun, nachdem TM-LehrerInnen - gemäß der vorherigen Infos ad TM - niemanden dazu auffordern sowas zu machen. Es steht allerdings auch TM-LehrerInnen keinesfalls zu, es jemanden zu verwehren, es als "Altar" im Rahmen dessen eigener Religion oder auch Religiösität zu interpretieren.




) welches dem muslimischen Verbot, Gott oder heilige Männer bildlich darzustellen, zuwiderlief. (Im Übrigen kann man ein Verbot der "bildlichen Darstellung" von Menschen, Tieren und Körperteilen sehr wohl auch dahingehend verstanden werden und verständlich sein, daß der Leichnam eines Menschen nunmal wirklich nur noch das Bild jenes Menschen und insofern das Bild eines Menschen ist; analog gilt das dann auch für Tiere und alle Lebewesen gleichermaßen. Ebenso gilt es für abgetrennte Körperteile. Ein Verbot Menschen, Tiere, Körperteile bildlich darzustellen, hieße demzufolge dann, daß  man eben Menschen, Tiere etc nicht töten darf, sich an Tötungen auch nicht beteiligen darf und auch niemandfem die hand abhaken darf odgl, da man ja sonst das Bild eines Körperteils "angefertigt" hätte. So eine zweite Darsellung von etwas, was man in einem Text an anderer Stelle bereits geäußert hatte, könnte dann die Absicht zugrundeliegen haben, ein Mißverständnis, das eine andere Textstelle evtl ja vielleicht noch nicht ausreichend ausgeschlossen haben könnte, an anderer Stelle in gewissem unabhängigem Zusammenhang, dann erneut zu verhindern sich zu bemühen, dh eine Rendunanz einzubauen. Insofern wäre dann eben auch da der Kunst sehr sinnvolle Schranken auferlegt, nämlich sich nicht dahingehend zu verirren, mit Blut & co  "malen" zu wollen, mit Tierfellen "Kunstwerke" wie "Pelzmäntel" & co anzufertigen usw usf, was aus der Sicht der yogischen Lebensideale "ahimsa & co" auch als Notwendigkeiten erscheint und insofern voll zu begrüßen sein würde. Der Begründer der "Sikh-Religion" hat sich darum bemüht, so las ich mal, Hinduismus und Islam als sich nicht grundsätzlich widersprechend darzulegen und in gewisser Weise "zusammen zu bringen"  - Quellenangabe folgt dann mal - )


Woimmer ich hinkam wurde mir, meinen Meister ehrend, Respekt entgegengebracht; das brachte ein Ausmaß an Prunk und Zeremoniellheit mit sich, was an Verehrung grenzte. Das bereitete mir nicht nur persönlich Unbehagen sondern ich fragte mich auch wieso Maharishi, der erste "moderne" Guru, es zuließ und förderte. Es erschien mir nicht nur als unverträglich mit der zentralen Lehre des Vedanta - wonach die materielle Welt eine Illusion ist - sondern erst recht erschien es mir unvereinbart mit jenem Freisein von Materialismus, welche von jemandem erwartet wird der erleuchtet ist.


Ironischerweise führte der Respekt den man mir in seinem Namen zollte zu Unglück für mich. Maharishi fing am mir, das Gefühl zu geben (vielleicht war es auch nur meine eigene Projektion), daß er das Gefühl habe ich würde mit Ihm einen spirituellen Popularitätswettstreit bestreiten. Bei mehr als einer Gelegenheit erwähnte er beiläufig, daß ich Verherrlichung meiner selbst suchen würde. Das war komisch angesichts dessen, daß er es gewesen war, der mich an die erste Stelle nach vorne geschoben hatte und der  darauf drang, darauf beharrte mich außerdem so sehr mit Hochachtung zu überhäufen, daß mir nichts anderes überblieb als es zu akzpetieren egal wie peinlich die Situation für mich auch war. Schließlich eskalierte die Situation. Im Juli 1993, während der Feiern anläßlich Guru Purnima, begab ich mich zu Maharishi in seine privaten Räumlichkeiten, um meine Anerkennung und Wertschätzung für Ihn zum Ausdruck zu bringen. Es war beinahe Mitternacht, es war nachdem all die Feirlichkeiten des Tages zu Ende gekommen waren. Rita und ich betraten das nahezu völlig dunkle Zimmer. Außer Maharishi war nur  1 Person noch eine Person anwesend, ein "höherer TM'ler", Benny Feldman, der sich still verhielt als Maharishi sagte: "Man berichtet mir, daß du mit mir konkurrierst".


Zu jenem Zeitpunkt hatte ich nur auf indirektem Weg von Berichten über seinen Verdruß, sein Mißfallen erfahren; dies war nun tatsächlich das erste Mal daß Maharishi etwas Anderes zum Audruck brachte als wie höchstes Vertrauen in mich. Es war Tatsache, daß er es nach seiner gesundheitlichen Krise ablehnte, sich über seine Gesundheit zu besprechen und Schmerzen auf sich nahm um zum Audruck zu bringen, daß ich zwar dereinst sein Arzt gewesen war und nun aber von mir erwartet wird, mich wie zuvor in die Rolle des Anhängers, Schülers einzuordnen und so zu betrachten habe. Dafür bewunderte ich ihn allerdings. Es wäre unverschämt, ungebührlich gewesen, wenn ich irgendeine andere Haltung angenommen hätte. In der näheren Umgebung von so jemanden wie Maharishi zu sein, heißt einen riesigen Unterschied im Bewußtsein festzustellen. (Anm. des Übersetzers: Zu "riesigen Unterschied im Bewußtsein" möchte ich anmerken, daß das wohl mit der Art der Beziehung zu tun hat, die man zu Mr. Mahesh unterhielt. Mr. Mahesh versprach "Wissenschaftlichkeit" und da gibt es selbstverständlich Wissensunterschiede zwischen Lehrer und Schüler. Wenn aber der Lehrer alle Zitatangeben einfach wegläßt und man mal dahintergekommen ist, ist es wissenschaftlicherweise höchst normal, dem betreffenden "Lehrer" nicht mehr all zu viel zu zu billigen und auch nicht Erleuchtetheit & co. Daß man, wenn die TM-Meditationstechnik jedoch zu gewissen unbestreitbaren positiven Auswirkungen führte - und die TM-Initiation auch nicht gerade sowas wie, vorgekommene, sexuelle Übergriffe von Pfarrern im Bereich der zB r.-kath. und ev.-luth. Kirche beinhaltete - man normaler bis wissenschaftlicherweise nunmal nicht zum Ergebnis kommen kann, daß das alles Humbug sei, ist dabei dann Eines. Daß aber Mr. Mahesh nicht als mehr zu betrachten ist als wie irgendein TM-Lehrer/eine TM-Lehrerin/ön TM-Lehrzwi ist dabei dann aber auch wissenschaftliche Normalität. Ob Mr. Mahesh dann erleuchtet war oder auch nicht spielt dabei eh keine Rolle, wie Er auch mal im "Kössenkurs" im Herbst 1971 in Kössen/Österreich selber - damals noch - zum Ausdruck brachte, als ihn jemand fragte, ob er erleuchtet sei und Mr. Mahesh dann in Konsistenz zu seiner damaligen Lehre-Darstellung antwortete: "ich fühle mich im Wachzustand wohl". Nunja, er schlief offenbar nicht, träumte auch nicht gerade im Rahmen eins üblichen Schlafes und außerdem war er auch nicht in dem was er als TM-Meditationszustand  bezeichnete, da er ja auch sichtlicherweise nicht meditierte.  Dr. Chopra mag hier aufgrund gewisser Überlieferungen, gewisser Themen in Indien - im Zusammenhang mit Meditationerlernen, sich auf einen Weg zur Erleuchtung zu begeben  - gewisse Fragen gestellt haben, die ihn dann wiederum, durchaus vernünftigerweise, zu solchen Überlegungen und Betrachtungen führen oder auch führten. Zusätzliche Fragen können zu zusätzlichen Problemen führen, na klar.Mr. Mahesh sagte auch auf dem TM-Lehrerausbildungskurs in Playa la Antilla/Spanien, 1973: "Der Meister im Meister ist Krischna". Das erwähnte Mr. Mahesh im Zusammenhang mit einem Vortrag über "Brahman-Bewußtsein"; er sagte weiter:" Krishna wird nach Erlangen von Brahman-Bewußtsein erkannt". Wer also als Hindu jene Kirshna als Gott verehrt, wird sich da sicherlich sehr ernsthaft, gewissenhaft und engagiert gewisse Fragen zu stellen schwerlich umhinkommen. Wie es ein Christ mit solchen Aussagen des Mr. Mahesh hält, ist dann wohl schwerlich abzusehen. Man kann zB von "Themaverfehlung" ausgehen oder aber auch es einfach nur zur Kenntnis nehmen oder auch sich sagen: "Nunja, wenigstens hält Er, Mr. Mahesh, sich also nicht für Gott". Im Übrigen gibt es im Christentum da ja auch so eine Aussage von deren Jesus, wonach er der Lehrer sei; wenn man aber als Schüler, sich dann während des Mathematik-Unterrichts etc dauernd mit dieser Frage befaßt, ob jetzt da Gott zu einem redete - oder mit der Frage, ob da der heilige Geist aus dem Munde der Lehrperson zu einem spreche -   oder doch Herr, Frau /Zwi sowieso, dann könnte es sein, daß man Probleme bekommt, dem Unterrichtsthema "Mathematik" zu folgen. Außerdem hat Mr. Mahesh, wie ich an anderer Stelle ausführlich darstelle, stets eine Ausrede für seine Lehrtätigkeit gesucht und gebraucht, da er ja gar nicht lehren hatte wollen und das damals anläßlich dessen was dann zu seinem ersten Vortrag geführt hatte/habe auch explizit verbal zum Ausdruck zu bringen versucht hatte/habe. Einerseits sollte Swami brahmanda Saraswati herhalten und so ständig jenes Bild von jenem hinter sich auf der Bühne. Andererseits jenes"Ich nahm es als den Willen Gottes", als jener Buchhändler jenen ersten Vortrag einfach angesetzt gehabt hatte. Nunja zurück zu "Kluft im Bewußtsein, Bewußtseinsunterschied". Es gibt unterschiedliche Bewußtseinszustände wier es auch in den Shivasutren zum Ausdruck kommt und im Übrigen auch Mr. Mahesh einräumt; es heißt bei Beiden auch, daß es eben noch ein "Viertes", Turyia gebe und ein sich regelmäßig in den Zustand des Samadhi begeben, zur Erkenntnis jenes absoluten Bewußtseins führen würde können. Auch Swami Shantanada Saraswati äußerte das in seinem Vortrag/Text über Meditation,den ich ja übersetzte und unter "Swami Shantanand Saraswati" zu finden ist. Auch er drückte - konsistent mit Mr. Mahesh - aus, daß ca 2-mal täglich eine 1/2 Stunde Meditationssitzungen aufzuwenden seien. Daß es eine Kluft gab zwischen Mr. Mahesh's Benehmen, gewissen Ansprüchen seinerseits und normalen wissenschaftlichen Gepflogenheiten räume ich sehr wohl ein - schon das "pledge" am Ende des TM-Lehrerausbildungskurses gehört zu solchen Unüblichkeiten; man studiert was mit ordnungsgemäßem Abschluß und darf dann eben seinen eigenen Betrieb aufmachen und muß nicht ein Leben lang bei seinem Lehrer bleiben und jenem sich unterwerfen sowie  seine Anordndungen befolgen; na klar, muß man es auch weiterhin als Mathematiker der Mathematik Recht machen und die Frau,dös Zwi, der Herr Professor müssen es aber auch - ob das nun mit "höherem Bewußtsein" zu erklären oder auch weg zu diskutieren ist, ist da eine andere Frage. Die Firma Hugendubel gab mal im hauseigenen Verlag ein Buch "Hariharananda, Kriya Yoga, Einführung in den geistigen Weg Shri Yukteswars und Yoganandas" heraus. Es stellte sich heraus, daß jener alte angebliche Swami und "Bruderschüler von Yogananda" ein Hoden-. und Busengrabscher war. Sein Assistent Peter van Breukelen bestätigte immerhin, daß der "Swamiji sowas bisweilen tue", als ich Ihn bei einem Treffen mit über 20 Personen darauf ansprach. Als ich mich bei der Fa. Hubendubel beschwerte, meinte man "der Swami hat ein sehr hohes Bewußtsein" und das zeigt, daß man mit "Bewußtseinsunterschieden" eben sehr vorsichtig zu sein hat. Bisweilen sind es ja auch nur stinkfaule, ziemlich perverse, ekelhafte, widerliche Ausreden; solche Leute reden sich auf etwas hinaus, was nicht faßbar ist. Das grenzt an das was Betrüger bisweilen tun, wenn sie anbieten mit etwas zu haften, was sie aber gar nicht haben.) Seine physische Verfassung war weiterhin erstaunlich gut, er war weiterhin erstaunlich bei Kräften, wenn man mal berücksichtigt, was er durchgemacht hatte.


Hier war er nun vor mir als jemand, der in meine Augen die Rolle eines verdrießlichen, reizbaren, eifersüchtigen, alten Mannes spielte dessen Stolz verletzt worden war. Ich für meinen Teil war entsetzt davon, daß er solchen Gerüchten Glauben schenken könnte. Dann stellte er an mich eine Forderung: "Ich möchte, daß Du mit dem Reisen aufhörst und hier im Ashram bei mir lebst." Er wollte auch, daß ich aufhöre, Bücher zu schreiben. Nachdem er das, was einem Ultimatum glich,  vorgebracht hatte, wurden mir 24 Stunden Zeit gegeben, mich zu entscheiden.


Es war ein kritischer Moment. Genau damals und ebendort hatte ich die Gesamtheit der Guru-Schüler-Beziehung zu betrachten, zu überdenken. Für jene, die nicht aus Indien kommen, umgeben diese gesamte Thematik, sich einen erleuchteten Lehrer zu erwählen, viele Mißverständnisse; auf jene, die nicht aus Indien stammen, kommen im Zusammenhang mit der Erwählung eines Erleuchteten als eigenen/eigene Guru/Guruini viele Mißverständnisse zu. Zu allererst ist festzuhalten, daß es im Westen eine Geneigtheit gibt, anzuzweifeln, daß Erleuchtung Wirklichkeit sein/werden könnte  es sei denn mit Buddha als Ausnahmeerscheinung oder aber auch gerade noch im Fall einer begrenzten Anzahl von Heiligen oder auch Weisen, die vor Jahrhunderten lebten. Im Westen gibt  es auch die Auffassung, daß einem Guru sich anzuvertrauen/einem Guru zu folgen, gleichbedeutend damit sei, für Ihn die gesamte eigene Persönlichkeit aufzugeben, Ihm sein Bankkonto und die eigene Würde zu übergeben. Keiner dieser strittigen Punkte betraf mich jedoch. in seiner Rolle als Guru war Maharishi authentisch, würdevoll, respekvoll und akzeptabel. Außerdem war er persönlich betrachtet liebenswert und es war eine Freude um ihn herum zu sein (auch wenn man Erörterungen - die sich über Stunden hinweg zogen und in denen es sich um dieselben grundlegenden Prinzipien drehte -  geduldig,diszipliniert,nachsichtig zu ertragen hatte.). Das Dilemma, dem ich gegenüberstand, war von grundlegender Natur: Kann ein wirklicher, echter Guru unfair, eifersüchtig, verzerrend/voreingenommen und letztlich manipulativ sein?

(Anmerkungen des Übersetzters dazu und zu "lesh avidya":

In Kössen/Österreich/Herbst 1971 wurde Mr. Mahesh mal sowas wie ansatzweise eifersüchtig und dann wütend auf Satyananda  - angeblich ehemaliger indischer Richter, der im Rentenalter dann auch bei Swami Brahmanda Saraswati einige Zeit verbracht habe und dann in jenen früheren Jahren Mr. Mahesh bisweilen begleitete; 1971 im Herbst hatte, was mich anbelangt, ich ihn dann allerdings auch das einzige und interessanterweise auch letzte Mal gesehen. -; Mr. Mahesh sagte, was mich damals verwunderte, ziemlich zornig: "I carry the responsibility, not Satyanand!";  wobei er den Namen Satyanand , in einem Tonfall von Verächtlichmachung, per einer davor palcierten, kurzen Pause auch noch betonte.

Scheinbar zusammenhanglos sprach er dann später von "lesh avidyia", was er als "Rest von Unwissenheit" übersetzte und er verglich es mit dem Fettfilm auf der Hand, wenn man einen Klumpen, sagen wir mal, Bio-Pflanzenmargarine - Mr. Mahesh sprach von "Butter"-Klumpen - zwar weggeworfen habe und die Margarine also  weg sei, aber die Hände eben noch etwas fettig seien. Ähnlich wäre es nach dem Erlangen von Erleuchtung: Man hat eben sozusagen noch fettige Hände und so ist/wäre das was man danach tut immer noch etwas von Unwissenheit belastet und das könnte anscheinend - so dann die Fortführung dessen, was Mr. Mahesh gesagt hatte - der Eine oder auch andere als Ausdruck von "Unerleuchtetheit", als abstoßend , anrüchig odgl empfinden. - Mr. Mahesh erheiterte sich damals an der Vorstellung, daß im Zustand der Erleuchtetheit das Leben ausgerechnet auf der Basis von jenem "lesh avidya" gelebt würde.

Vermutlich dachte er an jenen Vergleich von Sonne und Reflexion derselben in einem klareren Wasser, einem sumpfigeren, bewegterem oder auch weniger bewegtem Wasser oder auch einer sehr klar spiegelnden Oberfläche: Je nach Beschaffenheit des Reflektors wird man zwar immer noch erkennen, daß da die Sonne wiedergespiegelt wird; aber wenn man auf gewisse Feinheiten schaut wird man Unterschiede in der Präzision, Qualität verständlicherweise finden.

Offenkundig gilt das Mondlicht, selbst  des Vollmonds, als Widerspiegelung der Sonne am Mond und die Mondoberfläche erscheint - auch angesichts dessen was jene Astronauten berichteten und berichten konnten, die mal dort gelandet waren und von dort auch wieder zurückgekehrt sind -  keinesfalls als sonderlich geeignete Spiegelfläche; darüberhinaus werden bei jenem "Reflexionsvorgang" auch Strukturen der Mondoberfläche von Erden aus sichtbar, sodaß das reflektierte Sonnenlicht nunmal auch jene "Informationen" alsdann trägt, weiterleitet, schlichtweg enthält und wobei es allerdings insofern eine Tatsache ist, daß infolge jenes "Wissens - gemäß der Physik - um das Mondlicht und dessen Entstehung" selbst diese Informationen über die Mondoberfläche mit einem gewissen Grad an Faktischheit Teil des Sonnenlichts geworden sind. In der Analogie zu "lesh avidya" wären dann also vom "Kosmischen Bewußtsein" jene gewissen Qualitäten des Erleuchtung erlangt habenden Individuums übernommen worden und sie wären aber eben nur wie jene "Information über die Mondoberfläche", aber ohne Härte, Gefährlichkeit udgl.

Jenen Aspekt berücksichtigte Mr Mahesh damals anno Herbst 1971 in Kössen auch noch: Es wäre wie "geröstete Samen", die noch so aussehen wie jene Samen, sich so in etwa anfühlen udgl aber eben nicht mehr keimfähig sind. Dh jene "rudimentären" Zornigkeitsapsekte udgl könnten sich nicht mehr in hasserfüllte Taten, Verbrechen gegen Natur, Geschöpfe udgl entwickeln. Mit diesen Ausführungen bzw Hinweisen möchte ich weder Mr. Mahesh verteidigen noch Dr. Chopra kritisieren; es ist eben eine sachliche Feststellung, wobei zur Unterscheidung zwischen "faule Ausrede nur" oder tieferer Sinn, letztlicvh soweit zutreffend dargelegt, man wiederum die klassiche Literatur heranzuziehen hätte, um eine Quelle für das Wissen um "lesh avidya" zu finden, die man - unabhängig von Mr. Mahesh - für zuverlässig halten kann.

Im Sinne von Mr. Mahesh würde regelmäßige TM-Ausübung, dh 2-mal täglich jene ca 20 -30 Minuten, dem Einzelnen irgendwann soviel Vertrautheit mit "transzendentalem Bewußtsein" bescheren, daß das Individuum das irgendwann für sich erfahren und insofern würde verifizieren können. Nur wieso bis dahin, nicht auch klassische Quellen zu jenem Thema zur Kenntnis genommen zu haben? Findet sich dazu was in den Schriften Shankaras?)

Für einen hingebungsvollen Anhänger lautet die Antwort fraglos "Ja". Zur Rolle eines Anhängers gehört es nicht, einen Guru in Frage zu stellen, ihn anzweifeln; für ihn - AnhängerInzwi - gilt das genaue Gegenteil: Was auch immer der Guru sagt, wie befremdlich , launenhaft  oder auch unfair es auch immer sein mag, es habe als eine Wahrheit genommen zu werden. Die Rolle so eines Anhängers ist es, sich der Wahrheit anzupassen und es erfordert Kampf und "Tod des Ego" es zu bewältigen und die Überzeugung, daß die sprirituellen Früchte des strikten Gehorsams es wert sein werden.  Ein Guru spricht für Gott und reines Bewußtsein, er verleiht Gott und reinem Bewußtsein eine Stimme; deshalb gelten seine Worte als direkte, von Brahman herrührende, von Brahman selbst ausgehende Kommunikation, von jenem Brahman das uns besser kennt als wir uns selber. Im Prinzip ist/sei der Guru wie übermenschliche Eltern, die unsere Schritte lenken bis wir im Stande sind, selber zu gehen. Erfüllte Maharishi diese Aufgabe mir gegenüber, tat er das in Bezug auf mich?



(Ausführerliche Anmerkungen des Übersetzers zu jenem "Guru-Schüler-Beziehung" Problematik: siehe unter "22) seriöse Lehre versus "Guruismus"; Guruismus versus seriöse Lehren" )

...




Ab da bemühte Er sich weiter um den Erhalt der Veden für die Nachwelt und reiche Mäzen gründeten ein System zur Ausbildung von Brahmanen-Kindern zu Pandits. Das ganze geriet in Verruf als sich US-BürgerInnen darüber beschwerten, daß jene Kinder teils wie kasserniert zu leben hätte, teils ohne Aufenthaltsgenehmigung im Campus der Maharishi International University /Iowa/USA zu leben hätten und das ins ganz und gar nicht kindgerechter, nicht freiheitlicher Art und Weise. Ein Problem dabei ist auch, daß solche Pandits dann ja wohl erst mal eine Weile einen Teil der Einnahmen aus vedischen Zeremonien an die Mäzen zurückführen werden müssen und dabei auch die Namen der "Auftraggeber" eventuell ja "aus Abrechnungs-und Kontrollwecken für die Ehrlichkeit des Abführens" preiszugeben hätten, was dann wieder Datenmissbrauch durch den US-Staat sowie die US-Geheimdienste Tür&Tor öffnen könnte.


Mr. Mahesh gab über mehre Jahre hinweg auch eine wöchentliche internationale Pressekonferenz via Internet (mittwochs), in deren Rahmen ich Ihm die Frage vorzusetzen mich bemühte, ob Er sich damals in Südindien nicht verirrt haben könnte, einem Missverständnis aufsaß und aus seiner eigenen Unwissenheit oder auch Uninformiertheit absurderweise "einen Willen Gottes machte".

Seine Sekretäre zogen es leider vor, Ihm meine Frage nicht vorzusetzen und machten jene Hilfeleistung meinerseits für Ihn damit unmöglich/zunichte. Sie wollten Mr. Mahesh offenbar "für sich behalten" und hatten Freiheitlichkeit, Würde, Freiheit der Persönlichkeitsentfaltung (...auch gelten sollend für Mr. Mahesh!...) etc längst vergessen.

Statt meiner Frage setzten sie Mr. Mahesh dann die Frage eines US-Journalisten (Washington Post?) vor, die da lautete "Was halten Sie von Demokratie" (Als ob so einen, der im hintersten Gangestal nur für sich selber leben hatte wollen, das je interessiert gehabt haben hätte müssen und je viel angegangen wäre, nachdem in Indien dessen Lebensweise auch ohne Hilfe der USA & co anerkannt und toleriert worden war/wäre) und Mr. Mahesh antwortete - völlig unerwartet, patzig, total daneben - vor laufender Internet-Kamera (jener "frei verfügbaren Quelle, welche Verfassungsschutz, BND & co jederzeit "Abschöpfen" dürfen), daß er die Demokratie verfluche. Nunja, das war ein Tiefschlag gegen alle TM-LehrererInnen, die in so einer Staatsform leben, oder auch zu leben haben und damit klar zu kommen haben; freundlich, fürsorglich odgl war das von Mr. Mahesh nun gewiß nicht. TM-LehrerInnen konnten sich dann entscheiden: Eingestuft werden als potentielle Verfassungsfeinde - mit allen Konsquenzen - oder aber auch Kritik an und Distanzierung von Mr. Mahesh's unqualifizierten, groben, verletzenden Äußerungen. Nunja mir konnte es egal sein, nachdem ich mich ja schon ab 1976 aus jenen Organisationen & co zurückgezogen und Mr. Mahesh's Lehren kritisch und genauer unter die Lupe zu nehmen begonnen hatte.

Nunja, der US-Journalist ließ verständlicherweise nun nicht locker und in der nächsten oder auch übernächsten Internet-Pressekonferennz präzisierte Er seine Frage: "Was halten Sie vom freiheitlich-demokratischen System der Vereinigten Staaten von Amerika" und Mr. Mahesh wollte auch nicht nachgeben und legte nach: "Je eher es verschwunden ist, um so besser" und als ob das nicht schon mehr als schlimm  genug gewesen wäre, setzte Er noch d'rauf  "Das Prinzip des Wählens ist eine Verschwendung sozialer Resourcen". Gleichzeitig propa-gierte Er als die ideale Organisationsform für "sein" Wissen - das ja angeblich von Swami Brahmanda Saraswati alles hergekommen sei; "Oh jemine, dachte der genauso", ist die Frage, die Mr. Mahesh damit (leider nunmal, wahrlich nicht gerade hilfreich für die Shankaracharya-Tradition) aufwarf, "Absolute Monarchie mit Viel-Geld-Habenden als Königen". Au weia, das war aber fies von Mr. Mahesh oder hatte Er das etwa von Anfang an vorgehabt und wollte daher möglichst zahlreiche TM'lerInnen irgendwie "versammeln", um die für nötig gehaltene zahlenmäßige Macht dazu zusammen zu bekommen?

Man sieht unschwer, daß es besser gewesen wäre, Ihm damals meine Frage vorgesetzt zu haben, die zwar eine gewisse Kritik an Ihm - aber wohlwollende -  beinhaltete, aber Ihn zweifelsohne auf dem "Teppich" gehalten hätte und hoffentlich seinem Herumirren in  der Welt ein Ende per Verstehen,Begreifen,Wissen bereitet hätte und Ihm wenigstens noch jene paar Jährchen eben jener Lebensweise beschert haben würde können, welche Er doch angeblich mal unbedingt gewollt hatte und wofür Er ca 13 Jahre lang bei Swami Brahmanda Saraswati gelebt gehabt hatte.


Mr. Mahesh lebte zuletzt in den Niederlanden in Vlodropp, wo Er auch am  5.2.2008 verstarb.

Gemäß der klassischen Rituale wurde Mr. Mahesh's Leichnam dann in Indien eingeäschert und einige seiner AnhängerInnen flogen dazu dann extra nach Indien.


So vermochte Mr. Mahesh zu Lebzeiten jenen zweiten Teil des Rates des älteren Sadhus, nämlich "komme zurück" - ob einem das nun gefällt oder auch nicht - jedenfalls nicht zu erfüllen. Erst als mit Ihm kein Geld mehr zu machen war, wurde Er "vom Westen" dann als Leichnam nach Indien zurückgebracht, da sich mit einer "schicken Bestattungszeremonie" ja evtl noch Geld machen hätte lassen können?


Auf  Mr. Mahesh gehe ich in den Menüteilen "Mr Mahesh &TM auf Deutsch" bzw       "Mr Mahesh & TM in English" näher ein.



TM-Technik wie gelehrt worden von Mr. Mahesh:

Nachdem erstens  die TM-Mantren klassischen Ursprungs sind,

zweitens die Anweisungen für den Umgang damit doch sehr dem ähneln, was Swami Shantanand Saraswati in seinen "sayings", seinen "Worten von Swami Shatanand Saraswati" zum Ausdruck brachte und

Drittens die Initiationszeremonie eine Anerkennung der Leistungen der großen Yogameister - die "Literaturangabe", das Quellenverzeichnis insofern -  klassisch umfaßt,

erscheint es nicht ausgeschlossen, daß sich Mr. Mahesh in grundsätzlichen Belangen betreffs TM-Technik mit - von Swami Brahmanda Saraswati, ausgebildeten und per Initiation in Sannyasin für kompetent-genug befundenen - MeditationsspezialistInnen,  früher oder später, beriet und gegebenenfalls auch korrigieren ließ.

TM an sich, ist aufgrund dieser Sachverhalte als klassisch und zumindest durchaus möglicherweise ok im Sinne von  Shankaracharya Shantanand Saraswati zu bewerten und anzuerkennen. Welche Mantren Swami Shantanand Saraswati vergeben hätte, weiß ich leider nicht; aber anhand der Errecherchierbarkeit der TM-Mantren als "klassischer, seriöser, allgemein anerkannter Mantren" einerseits und andererseits der TM-Technik, wonach es ja eh auf den Laut an sich ankommt, komme ich nicht umhin die TM-Technik an sich für "ok" zu befinden. Damit sage ich nicht, daß die Vorabinformationen auch als "Ok" einzustufen wären. In der Tat bin ich da der Überzeugung, daß diese nicht ausreichten und die weitreichenden Folgen von Erlangen von momentanem Samadhi bzw gar von dauerhaftem Samadadhi "nitya samadhi" entweder absichtlich verschwiegen wurden oder aber aus Unwissenheit und insofern Guru-Inkompetenzheit unterblieben.


Allerdings las ich zu meinem Entsetzen in einem dicken Medizinschmöcker (genaue Zitatangabe folgt selbstverständlich noch) - mit "Prof. Dr. med." als Verfasser & co darauf - einen nicht kleingedruckten, offenbar sehr ernst gemeinten Absatz über "wie man meditiert und mit Mantren umgehen solle". Nunja, Prof Dr. med. hatte/hat mindest ebensoviel "Guru-Inkompetenezheit" wie sie Mr. Mahesh etliche Jahre an den Tag legte. Nur Mr. Mahesh hielt dann mal jenen Vortrag in dem er wenigstens erwähnte, daß das "Ausüben von Samadhi" auch Ahimsa & co daherbringe, so wie der ganze Tisch daher kommt, wenn man an einem Tischbein zieht. Insofern hätten es die Medizinprofessoren wirklich wissen können und müssen, nachdem zwei der Ihrigen ja jene fiesen Gutachten gegen "TM" für die Prozesse im Zusammenhang mit den Anschuldigungen der            Dr.-Kohl-Bundesregierung gegen TM schrieben. Man sieht die Medizinerschaft hat 0,0 Ahnung von jener Materie und den möglichen Problemen sowie der Natur jener Probleme als nicht-krankheitseiend. Es ist wirklich schlimm  feststellen zu müssen, daß jene Medizinprofeesoren nicht einmal Yogavashishta und die Bhgavad Gita einigermaßen genau gelesen gehabt haben können! Sie wollen zu allem etwas sagen können und richten nichts als Unheil damit an. Arroganz, Wissenshabgier, Zuständigkeitenhaben-und-Einfluß-Habenwollen-Gier udgl am Werke, aber nicht Know-How, nicht Ahnung und va keinerlei Verantwortungsbewußtsein! Da hatte Mr.  Mahesh in der Tat mehr Verantwortungsbewußtsein und in der TM-Scene hatte - und, oh je, hat man sogar auch in der Gegenwart - man mehr Chance von Problemen am Ende nicht überrollt zu werden.


Ich gehe auf obige Punkte ja ausführlich im Rahmen der entsprechenden Gliederungspunkte ein.


Laut Mr. Mahesh habe Swami Brahmanda Saraswati Ihm die  transzendentale Meditation gelehrt. Nachdem Mr. Mahesh jenen Swami Brahmanda Saraswati aber gefragt habe, ob Er sein Schüler werden dürfe, Swami Brahmananda Saraswati damals aber noch nicht Shankaracharya war und Er Mr. Mahesh geantwortet habe, daß er besser erst sein Studium fertig mache und dann dürfe er kommen, ist nicht auszuschließen, daß Swami Brahmananda Saraswati Ihn dann - neben seiner Tätigkeit als Shankaracharya  - auch privat unterrichtete um so sein Versprechen, das er als Sadhu an Mr. Mahesh gegeben hatte, einzulösen. Insofern könnte Er also Mr. Mahesh jene "Transzendentale Meditation, unabhängig von der, sozusagen "amtlichen", Shankaracharya-Tradition gelehrt haben. Siehe dazu ausführlichere Überlegungen und Nacherzählungen von Mr. Mahesh's Aussagen dazu unter  Mr Mahesh & TM auf Deutsch .



Der 7-Schritte-Kurs zum Erlernen dieser Transzendentalen Meditation, wie sie bis ca 1975 gelehrt wurde war so ganz schlecht nicht.

Allerdings müßte der erste Tag jener 3 Tage "Checking" nach der Initiation am Abend jenes Tages stattfinden, an welchem die Initiation stattfand und ohne daß die Neu-Initiierten bereits alleine versuchten "TM" auszuüben.

Desweiteren hätte man im ersten Vortrag vor der Anmeldung zu so einem TM-Kurs, die Interessenten darauf hinweisen müssen, daß die Praxis von Samadhi wie das Ziehen an einem Tischbeinen eines Tisches mit 8 Beinen, lt. einer Rede von Mr. Mahesh, ist und demzufolge auch die anderen Aspekte einer yogischen Lebensweise, nämlich ahimsa (Nicht-Töten), Nicht-Verletzen, Nicht-Heftigkeit, yogischer Umgang mit Sexualität udgl. sich einstellen könnten, zu erwartenderweise sogar sollten und Manche also wie plötzlich , wie aus dem Nichts sich Konflikten mit dem Alltag, uU auch mit FreundInnen, Familie usw usf ausgesetzt wiederfinden, sehen könnten. Dazu dann auch ein Zitat von Buddha aus "die vier edlen Wahrheiten" wo und wie Buddha einen seiner Mönchen zurechtwies, der nur noch die "richtige Meditation" lehrte und lehren wollte und über "rechten Lebenswandel" kein Wort mehr verlor bzw verlieren wollte. Dieser enge Zusammenhang betreffs des Bewußtseins und dem Geist (und damit dann auch der Welt des Tätigseins) kommt auch in den Shivasutras in Vers 15 des 1.Kapitels, titels "Saambhavopaaya" zum Ausdruck. Auch in den 2 großen Epen Indiens, dem Ramayana (oder auch Mahavasishta) bzw dem Mahabharata wird das mit den jeweiligen Belehrungen in den 2 "Kern-Kapiteln" dem Yogavasishta bzw der Bhagavad Gita mit der Beleherung des Prinzen Rama durch Rishi Vasishta bzw der Belehrung des Bogenschützen Arjuna durch Krishna in aller Dramatik dargestellt. Beidemale ist die Moral von der Geschichte, daß man sich vorher mit dem "Rechten Lebenswandel" zu befassen habe, die richtige Richtung eingeschlagen zu haben hat, ein klares Verständnis in Bezug auf die Anforderungen und die eigenen Möglichkeiten sich zu erwerben hat, da es ansonsten sehr tragisch und zwar tödlich enden könnte, wenn nicht zufällig ein wahrer Super-Guru des Formats Hr. Rishi Vasishta oder auch Hr. Krishna zur Verfügung sein sollte.

An diese Stelle gehört sicherlich auch jene Geschichte, die Mr. Mahesh bzgl. Swami Brahmanda Saraswati wiederholt erzählte: Der Junge sollte im Alter von ca 9 zwangsverheiratet werden, was er entschieden ablehnte, da Er sich für den "Sadhu-Weg" entschieden hatte; also lief er von zuhause fort. Mit einer speziellen Frage versuchte Er zu verhindern, daß Er an einen falschen Guru käme und nach einigen Jahren habe er in Swami Krishnanand jemand gefunden, der seinen Vorstellungen und Überlegungen genügt habe. Er habe dann bis zum 75'ten Lebensjahr jenen Lebensstil gepflegt und sei dann Shankaracharya geworden. Nunja, ich hatte mich klar entschieden gehabt jedenfalls vor Volljährigwerdung nicht TM anzufangen, ein hierzulande "übliches" Leben zu leben, mich mit der Frage, ob ich TM überhaupt jemals anfangen werden, mich erst später zu befassen. Aber Mitglieder der "TM-Scene", die "ihrem "großen Meister" seine Freiheit zubilligten, davon gelaufen zu sein und seinen Lebensstil zu pflegen, hatten mir meinen Lebensweg absurder- und peinlichsterweise nicht gelassen.

Damit ist man dann schon beim nächsten Aspekt:


Kostenseite und organisatorische Regeln sind ein anderes, eigenes Thema und Etliches war mangelhaft. Insbesondere war der Schutz Minderjähriger nicht ausreichend; ebenso war der Schutz von noch in Ausbildung Seiender, inkl. Studierender nicht gewährleistet; man versuchte selbst noch aus jenen Reihen, "Fulltime-ArbeiterInnen" zum Nulltarif zu rekrutieren.


Zeitlich in etwa ab dem Tod von Tat Wale Baba fing Mr. Mahesh leider an, immer weiter in eine Fantasiewelt abzudriften; spätestens mit seinem "Traum" von einem "Zeitalter der Erleuchtung" waren Er und einige seiner "Getreuen" so ziemlich außer Rand und Band und versuchten einen "Mr. Mahesh-Kult" aufzubauen. Er verwickelte sich in Widersprüche: Erst sollten allenfalls Ehepartner gemeinsam meditieren dürfen; ab ca 1976 hieß es dann "Gruppenmeditationen" sind besonders wichtig und alle sollten daran teilnehmen. Spätestens seit den Berichten gewisser, sexuell-ekelhafter Meditationserfahrungen (infolge fehlerhafter TM-Ausübung), die ein erwachsener (der Sprache, dem Slang nach) "US"-TM'ler in Gegenwart von Minderjährigen im Rahmen jenes Kurses im Herbst 1971 in Kössen/Österreich zum Besten gab, wußte Mr. Mahesh, daß jene Anweisung "alleine Meditieren" wirklich not-wendig war. Auch ging es ab ca 1975 an, daß im Rahmen der TM-Kurse niemand mehr alleine die Kurs-Räumlichkeiten verlassen sollte dürfen, dh "Kasernierung" hielt zunehmend Einzug. (Grund dafür waren ca 3 Amis, die im Rahmen eines TM-Lehrer-Fortbildungskurses 1974 in Arosa/Schweiz plötzlich auf die absurde Idee kamen, daß sie nebenher was pro Geldsegen /Geldregen tun könnten, wenn sie sich in eine lokale Bank-Filiale hineinsetzen und dort ihre Meditationsübungen veranstalten täten. Jemand - von der Bank? - beschwerte sich über sie bei Mr. Mahesh.).


Ab Frühjahr/Sommer 1976 - außer ab-und-zu via (ein Zeit lang) wöchentlichen Pressekonferenzen via Internet des Mr. Mahesh habe - ich dann keine weiteren genaueren Informationen mehr aus eigener Anwesenheit heraus, sodaß ich dazu auch keine weitere Stellungnahme abgeben möchte.



TM an sich, mal abgesehen von den mangelhaften vorherigen Strategieüberlegungen, halte ich für ok; es eröffnete mir, anerkennenswerter- und erfreulicherweise, einen interessanten, hilfreichen, wohltuenden Zugang zur klassischen indischen Geisteswelt.


Das soziale Chaos, das man, trittbrettfahrend bei der Unfähigkeit jenes Deutschlehrer eines naturwissenschaftlich-mathematischen Gymnasiums, mittels der "stümperhaften" "TM-Scene", jenem mangelhaftem Vereinsleben verursachte ist und bleibt unverzeihlich. 

Dabei haben sich manche TM-LehrerInnen als nicht schädlich bis hin zu erfreulich erwiesen; aber leider vermochten sie gegen die destruktive Wirkung jener relativ wenigen Anderer nichts auszurichten. (Dazu gehören Dr. Peter Hellerich - der u.a.strategisches Denken konnte - und Thurid Müller-Elmau - die sich ua sehr gut benehmen konnte - ebenso wie Adolf Beck und Max Aigner aber auch Andere.)

Na klar hatte mal jener Dr. der Volkswirtschaften ca 1 Jahr lang ein eigenes TM-Center betrieben und dort war "Strategie" nunmal "lebendig" und das Ganze war und blieb in einem soliden, seriösen, unschädlichen, auch Kritik an TM'lerInnen übenden Rahmen; das lag sicherlich auch an seiner selbstbeherrschten Partnerin. Außerdem beherrschten sie, daß man mit TM-Scene auch Schluß machen könne bzw können sollte.

Aber was vorher war und danach kam, war indiskutabel; vorher war's ein "Dr. med. und nachher war's ein Dr. der Philosophie, der am Ende eine Beziehung zu einer 14-Jährigen unterhielt (nachdem er sie als ca 11-jährige mal initiiert gehabt hatte), auweia! Der Dr. med. hörte 1976 mit "TM" ganz auf und machte dann "Silver mind controll" aus Südafrika, was sich reichlich g'spinnert anhörte, als Er es mir verzählte; außerdem war es in "seinem" Center gewesen, in welchem mich M.H. damals einfach idiotischerweise initiierte und es waren eben nicht Hunderte von Initiationen pro Woche, sodaß es für ihn kaum mehr möglich gewesen wäre den Überblick zu behalten. Aber so wirklich besonders unerfreulich war als Frau Ilse Eickhoff - jene Ober-Super-TM-Lehrerin aus der Sicht des Mr. Mahesh, der ihr ja die Vergabe jener sog. Fortgeschrittenentechniken anvertraut und zugetraut hatte - mir im Herbst 1972 eine "Fortgeschrittentechnik" gab und auch kein schriftliches Ok der Erziehungsberechtigten verlangte, keines hatte, selbstverständlich auch keine Fälschung von mir bekam und doch eine Initiation vornahm. Sie hätte es aber eigentlich schon gemerkt haben müssen, wo sie doch jene Ober-Super-TM-Lehrerin war; aber nein stattdessen wollte sie Geld machen und lud mich in ihre Akademie nach Bremen ein, wo ich aber nie hinfuhr. Das war dann aber - bei allem Verständnis für jene sich mühenden Art Laien - , betreffs  Renundanz, schon sehr merkwürdig und einfach nur noch mangelhaft.




Kundalini:

Im Rahmen eimes TM-Lehrer-Fortbildungskurses ("ATR"-Kurs, advanced teacher training course) in Arosa/Schweiz fragte eine TM-Lehrerin (der Sprache nach vermutlich USA) Mr. Mahsh betreffs ihrer eigenen Erfahrungen von "Kundalini-Erwecktheit". Mr Mahesh antwortete - völlig im Widerspruch zu seinem Versprechen, eine alltagstauglichen "Weg" anzubieten - , daß sie sitzend schlafen solle, was ich für einen Schmarrn hielt und halte. Jene TM-Lehrerin beschwerte sich und erwiderte, daß sie aber doch müde sei. Mr. Mahesh beharrte auf seinem Standpunkt und riet ihr ein Kissen zu benutzen. Dann brach er das Gespräch mit jener TM-Lehererin ziemlich grob ab, indem er -  ziemlich grantig in der Sprache, aber auch grinsend - in die Runde fragte, wer sonst noch Kundalini-Erfahrung habe und fragte erst mal nach "Kundalini im Bereich des unteren Endes der Wirbelsäule".  Es meldeten sich von den Anwesenden ca 100 bis 200 Personen daraufhin ca 15 bis 20. Mr. Mahesh fragte weiter nach "bis zur Brust"; es meldeten sich noch ca 7 -10. Dann fragte er weiter bis "bis hinauf da an die Oberseite des Kopfes bzw knapp darüber" und es meldeten sich noch ca 3. Da er merkte, daß ich mich immer noch nicht gemeldet , herschte er in die Runde hinein: "Wer sonst noch?". Mit soviel Getue hatte ich nicht gerechnet und hob - versehentlich - meinen Arm. (Ich wußte damals noch nicht, daß "Kundalini-Erfahrung" vonseiten der total ignoranten und arroganten deutschen Psychiatrie als "psychische Erkranktheit" gilt. Ich hatte mit Kundalini nie Probleme, sie war damals im Herbst 1971 in Kössen erwacht -  man sagt das halt so "Kundalini ist erwacht". Ich schlief stets im sitzen - probierte das mit dem sitzend Schlafen im Rahmen ATR-Kurses ein paar mal und stellre fest, daß ich mich nach dem Einschlafen immer sogleich hingelegt hatte; also was sollte das ganze blöde Getue? Es gibt ad "Kundalini" jenes schockierend wirken könnende Buch von Gopi Kirshna, der bei dem Erwachen von Kundalini erst mal Probleme bekam. Wenn ich aber mal berücksichtige, daß Herr Gopi Kirshna am Ende seines Lebens ein ganzes Buch in wenigen Wochen verfaßte, dh immer noch ziemlich rücksichtlos mit seiner Gesundheit umging, so vermute ich, daß er in jungen Jahren noch rücksichtsloser, gewaltätiger mit seiner Gesundheit umgegangen sein könnte. Er hatte, gemäß eigener Schilderung, mit einer Yoga-Übung begonnen, weil er seine eigene Faulheit hatte überwinden wollen. Insofern kann ich mir durchaus vorstellen, daß bei dem Erwachen von Kundalini er der schlechten gesundheitlichen Verfassung seiner selbst tatsächlich doch immerhin mal gewahr geworden war. Kundalini ist sowas wie das Erlangthaben von "Entspanntheit", das Wachgewordensein des "Impulses der Entspannung", der zur Entspanntheit führte. Ordnet man dann sein Leben vernünftig und lebt ein so einigermaßen gutes Leben, ein gut-mögliches Leben, so bleibt man auch während des Alltags entspannt und steigert sich nicht in relative Unwichtigkeiten auch noch hinein.Es heißt keinesfalls, daß man einen Beruf nicht mehr ausüben würde können etc oder plötzlich aus "Eingebungen" heraus komische Sachen machen täte/müßte. Wieso sollte man zB Mathematik nicht auch entspannt betrreiben können? Da macht es doch schließlich erst richtig Spaß, dh man behält die notwendige innere Distanz dazu, statt zu einem blindwütigen Fachidioten zu werden! Eine interessante, nunmehr 100 Jahre alt, Darstellung zum Thema "Kundalini" stammt von Sir John Woodroffe, alias Arthur Avalon "Die Schlangenkraft, die Entfaltung schöpferischer Kräfte im Menschen", in deutcher Übersetzung vorliegend vom O.W.Barth-Verlag, zB ausleihbar in der Zentralbibliothek der Stadtbibliothek München im Gasteig/München. Das Vorwort stammt von Sir John Woodroffe vom 20.September 1918 aus Ranchi/Indien, unterschrieben mit Arthur Avalon. Man findet dort auch 2 klassische Texte dazu, welche Sir John Woodroffe aus dem Sanskrit ins Englische übersetzte.




 

 

 

 





Zum Verständnis noch Folgendes, auch wenn das zu Gaudapada, Shankara und den Shivasutren - bei all diesen stehen Turyia und das Wechselspiel der Bewußtseinszustände Wachen, Träumen und Schlafen im Vordergrund - im Zentrum: Nun ist es erfahrungsgemäß so, daß Schlafen mit einer gewissen Erfahrung des Schlafzustandes verbunden ist; Träumen ist ebenfalls mit einer bestimmten Erfahrung , nämlich jenem speziellen Bewußtseinszustand, jenem Bewußtseinsphänomen verbunden. Ebenso ist es mit dem Wachzustand, der einerseits für das alleinseeligmachende Wahre, Real gehalten wird und andererseits ist es doch so, daß selbst der engagiertes Geldmacher , die engaiertesten PolitikerInnen usw irgendwann am Tag nichts besseres mehr zu tun iwssen und zu tun haben, als möglichst all das zu vergessen, all das auch wieder vergessen zu können und möglichst tief und fest zu Schlafen und dann also jenes andere Bewußtseinsphänomen, jenen anderen Bewußtseinszustand wieder bevorzugen. So sind diese 3 Bewußtseinszustände Wachen, Träumen, Schlafen nichts anderes als spezielle Bewußtseinsphänomene und insofern Ausprägungen von, um es gemäß deutscher Philosophiesprache auch mal zu bezeichnen, "Bewußtsein an sich" oder um es eher klassisch indisch philosophisch zu bezeichnen, von absolutem Bewußtsein oder auch um es mit Worten des Mr. Mahesh mal zu nennen, von reinem Bewußtsein.  Nun erscheint es als Binsenweisheit, daß es bei anderen Menschen sich ebenso verhält und es bei jenen auch jene Bewußtseinsausprägungen, Ausprägungen absoluten Bewußtseins samt dem, daß es sich um Ausprägungen absoluten Bewußtseins handelt, gibt. Soweit so klar. Nun ist der Unterschied zwischen diesem intellektuellen, mit Verbalität und den Konkretheiten jener 3 Bewußtseinszustände verbundnenm "Verständnis" Erkenntnis im Sinnne von Yoga, Tantra bzw im Zusammenhang mit Kundalini und Sir John Woodroffes klassischen Texten dazu, der, daß es sich nun - also bei Yoga, Tantra, Kundalini... - um eine Erkenntnis auf der Ebene jenes absoluten, reinen Bewußtseins handelt; jenes     alldurchdringende, dh Wachen, Träumen und Schlafen durchdringende Bewußtseins, wovon Wachen, Träume und Schlafen "nur" Ausprägungen davon sind, erkennt als sich selbst die Identität, Wesensgleichheit mit jenem reinen Bewußtseins - wovon Wachen, Träumen und Schlafen eines Anderen "nur" Ausdruck sind -. Nun missverstehen Viele - allen voran sog. "Psychiatrie"-Sachverständige - solche Aussagen, welche jenes Phänomen jener Erkenntnis einerseits und jener Wesensgleichheit andererseits beschreiben bzw, zu beschreiben ein Bemühen zu einer bestimmten Zeit unter irgendwelchen Umständen  in gewisser Umgebung darstellen, als Blödsinn alà "Geh so nen Schmarrn, ich bin doch nicht der Andere, da muß es doch nen grundsätzlichen Unterschied geben, da täte ich mich ja für den Anderen halten bzw für jemanden halten, der ich doch gar nicht bin, usw, da wäre ich ja nix als wahnsinnig, verrückt geworden". Es ist aber tatsächlich nichts als ein Missverstehen der Realität, da man hübsch man selber bleibt und der andere bleibt jemand Anderes. Lediglich ist es so, daß man das Spiel jener 3-Bewußtseinszustände nun in Nicht-Abhängigkeit, dh in Freiheit, mit der transzendenten Distanz welche eben jenes transzendentale, reine, absolute Bewußtsein ihr Eigen nennt erlebt und sich lebendig vorstellen kann, einfach ein Wesen aus reinem Bewußtsein zu sein und nach dem Ende des mit diesem Körper  verbundenen Wechselspiels von Wachen, Träumen und Schlafens, dh dem Tod, als Solches weiter zu existieren.

Solches erlangt zu haben, wird anscheinend zB Swami Brahmanda Sarawati in Indien vielfach nachgesagt; er wird anscheinend von Etlichen als so ein Wesen verehrt.    Traditionell wird das Erlangen jener Erkenntnis auf der Ebene des transzendentalen, absoluten, reinen Bewußtseins selber, dargestellt als die Vereinigung  des scheinbar strömenden, fließenden Bewußtseinstroms - wohl als Kundalini bezeichnet - mit dem eher als ruhenden, fix seienden Bewußtseins-"Sees" im Bereich des Scheitels geschilderten "Bewußtseins". Übt man "TM" aus, kann es zu einem Zustand einer gewisse transzendentalen Wachheit führen, was üblicherweise mit dem Kopf in Verbindung gebracht wird. Nach Erwachen der Kundalini wird auch das als "transzendentales Bewußtsein" erfahren, was man eben üblicherweise dann mit dem unteren Ende der Wirbelsäule (das hat, im Gegensatz zu einem weit verbreiteten Missverständnis, mit Sexualorganen etc nicht mehr zu tun als ein Bildnis des Erden-Mondes mit einem Bildnis von einem Marsmond  oder auch Saturmond.) in Verbindung bringt. Zunehmendes "freies Fließen" der Kundalini durch fortgesetzte Meditation morgens und abends - je ca 1/2 Stunden gemäß Swami Shantananad Saraswati -  führt eben dazu, daß man - im Vergleich: den See, den Ozean und das, ja auch nicht von Quelle bis Mündung gleichzeitig erlebbare, Fließen eines Flusses zur umfassenden Wahrheit  über jenen "Wasserkreislauf" - Jene Wesensgleichheit als "reines Bewußtsein" irgendwann als eigenes Bewußtseinsphänomen, Bewußtseins-Sein erkennt, erlebt und dann einfach halt lebt. Falls es solche Lebewesen , die jene Bewußtseinseinheit erkannt haben, Unsterblichkeit erlangt haben usw geben, so könnten sie ja uU dabei "nachgeholfen" haben, "behilflich" gewesen zu sein sich irgendwann heraustellen. Aber dann war man ja selber schon zu so einem Wesen geworden und es macht einem keine Probleme das anzuerkennen, was man als sich selber ja auch anzuerkennen eh nicht umhinkommt. Also wieso sollte man sich darüber vorher schon groß den Kopf zerbrechen? Nunja, es gibt jene traditionelle Darstellung wonach es die Vereinigung einer Gemahlin Shivas mit Shiva wäre, ja ja. Aber wer weiß schon, ob man da nicht vielleicht in Wahrheit dann nur, falls es halt nunmal  -.... angenommen daß...,-  jene geben sollte erkannt haben wird, daß Shiva nunmal Shiva ist und seine Gemahlin ist seine Gemahlin und ihr Eheband zwsichen ihnen sowie ihre eheliche Treue zu einander sind so unsterblich wie sie und daß all die komischen Fantasien, die man zuvor gehabt haben möge, nichts als Täuschungen gewesen waren, die keinerlei Wahrheitsgehalt hatten und ohne jeglicher Wirkung und Bedeutung waren und blieben.

Nun, es ist wohl so ähnlich zu verstehen als wie wenn man versteht, daß das Wasser des Flusses, das Wasser des Regens und das Wasser des Ozeans im Zusammenhang miteinander stehen und all das nichts als "Ausprägungen von Wasser" sind. Kundalini ist eben in Wirklichkeit eins mit absolutem Bewußtseins, eben auch nie endend, immer voll, wie ein immer voller, scheinbar sich nie wirklich verändernder See. "ich bin das, Du bist das, all dies ist das". Aber bei all der Einheit als Wasser, bleibt der Fluß ein Fluß,ein See ein  See, ein Ozean ein Ozean; aber aufgrund des "Zusammenhangs" werden Ozean,m See und Fluß sozusagen als "nie endend erkannt" und nun als "nie endend" gewußt, was die Sorge tilgte, daß der Fluß eines Tages aufhören könnte zu fließen, der Ozean eines Tages leer sein könnte, usw. Während nun im Vergleich zu Fluß, See, Regen, Ozean sicherlich gewisse Veränderungen möglich sind und die "Ewigkeit der Fülle" nicht so genau genommen werden darf, wenn man es als sinnvolle Metapher versteht - dh wie ich es als Autor nunmal gemeint habe -, so ist es auf der Ebene des Bewußtseins so, daß es dann eben nur noch mit Begriffen wie "Unsterblichkeit", "Ewiger Fülle", "nimmt man von Fülle eine Fülle weg, bleibt die Fülle voll" usw einigermaßen beschrieben, bezeichnet werden kann.





Meiner Ansicht nach war Mr. Mahesh der Aufgabe - insbesondere der organisatorischen Aufgaben - die er angenommen hatte - angesichts des angerichtete Chaoses im Leben, nicht vernachlässigbar Weniger, Einzelner - nicht gewachsen. TM-Lehre, selbst und auch der TM-Kurs alà Playa La Antilla/Spanien 1973 waren erstaunlich gut und - mit ua den erwähnten "Kleinigkeiten", aber nicht Unwesentlichkeiten sehr brauchbar. Leider wurde dann aus dem 3-Monatskurs alsbald ein 6-Monatskurs, Preisexplosion zog ein, usw usf.


Das ist nunmal die Situation


( ....wenigstens ein  wenig distanzierte Informationen findet man zB auch bei: https://vedanta-yoga.de/maharishi-mahesh-yogi/; Es heißt dort ua.:

>> Noch ein paar Worte über die Tradition des Maharishi"........"Jyotir Math im Himalaya bei Badrinath war lange Zeit ohne einen geeigneten Leiter da sich niemand geeignetes finden ließ. Brahmananda wurde nachdem er Jahrzehnte in einer Höhle ausschliesslich meditiert hat, im Alter von 70 Jahren zum Nachfolger Shankaracharyas ernannt. Er bekam den Namen „Gurudev Shri Shankaracharya Brahmananda Saraswati von Jyotir Math“ Tatsächlich gilt es als umstritten ob Maharishi Mahesh Yogi tatsächlich authorisierter Lehrer in der Tradition Shankaras gewesen ist, er war Sekretär von Brahmananda und es gab keine Bestätigung über seine Einweihung.<< .....)

Dort kann man auch ein Video mit Mr. Mahesh und den Beatles sehen.Es enthält ua ein Interview von David Lynch mit Paul Mc. Cartney; dieses Interview ist sichtlich neueren Datums; es enthält also die Meinung von Paul Mc Cartney aus einer gewissen Distanz zu jener Zeit bei Mr. Mahesh in Rishikesh im Februar 1968. Das Interview war anscheinend anläßlich der David Lynch Show  "Change begins within" am 4.4.2009 in der Radio City Music Hall in New York City.


Eine weitere distanzierte Darstellung findet sich zB in: "Das große O.W. Barth-Buch der Meditation" von Oliver Bottoni, erschienen im O.W. Barth-Verlag, 2006, S. 322 bis 325, ISBN 13: 978-3-502-61141-7, ISBN 10: 3-502-61141-6 ....)



deutschsprachige Literatur im Zusammenhang Mahesh Prasad Varma dem es widerfuhr, daß Er Maharishi Mahesh Yogi genannt wurde:

"Die Wissenschaft vom Sein und Kunst des Lebens", SRM-publications, 1969

 

"Die Wissenschaft vom Sein und die Kunst des Lebens", Taschenbuch: 464 Seiten, Verlag: J. Kamphausen Verlag; Auflage: 7. Auflage 2017 (15. Januar 2010), ISBN-10: 3933496403, ISBN-13: 978-3933496409

"Bhagavad Gita". Kapitel 1 - 6. , Taschenbuch: 480 Seiten, Verlag: J. Kamphausen Verlag; Auflage: 3. Auflage 2017 (1. April 1999), ISBN-10: 3933496411, ISBN-13: 978-3933496416


Es ist nicht so, daß Mr. Mahesh im Zusammenhang mit seinen Lehrbemühungen niemand außer sich selber jemals zu Wort kommen hätte lassen:



13) Tat Wale Baba:

Im Internet findet sich eine Rede von Tat Wale Baba zu TM'lern:       https://www.youtube.com/watch?v=JusE_IWSnTk , es heißt dazu:   "Audio tape of MAHARISHI and TAT WALE BABA Rishikesh 1969"                             

(...vermutlich im Rahmen eines TM-Lehrerausbildungskurses in Rishikesh...), die ich hier mal - von Mr. Mahesh ins Englische übersetzt und dann von mir vom Englischen ins Deutsche  übersetzt - wiedergebe:

Beginn jenes YouTube-Videos, dessen Sprach-Text ich hier übersetzt wiedergebe


https://www.youtube.com/watch?v=JusE_IWSnTk


Mr. Mahesh: Gespräch über Transzendentale Meditation 
                      Ist es hier da?                                                
                      Dann komm her und fange an zu sprechen. 
 .....
                       Ja, hole einige Stühle von dort, von der Bühne.                                           
                       Bis 4 Uhr pflegt Er zu meditieren.                                                                
                       Aber als ich heute ein Wort zu Ihm sagte, daß einige                                   
                       Leute um 4 Uhr wegen eines fahrplanmäßigen Termins gehen                                            müssen......., sagte Er, daß Er                                                                        
                       kommen werde.                                                                                             
                       Ihr möchtet etwas von Ihm hören? Dann stellt Ihm                                      
                       eine Frage.

 .......(irgendwer scheint etwas zu fragen; aber leider unverständlich, da zu leise)         

Tat Wale Baba: AUM
Tat Wale Baba (Mr. Mahesh übersetzt):
                       Was ist das Ziel aller Lebewesen?
                       Das Erreichen unendlichen Glücks.
                       Beendigung des Leidens und Erreichen von ewigem
                       Glücklichsein, das wollen wir.
                       Jetzt sollten wir unterscheidendes Denken an den Tag
                       legen und herausfinden wo es da irgendetwas gibt, das
                       uns dauerhaftes, ewiges Glücklichsein geben könnte.
                       Vom Ende bis hinauf zum Bereich des Schöpfer sind
                       alle im Bereich des Wandels, relativer Werte.
                       Unendliches Glück kann nur von etwas kommen, das                    
                       unsterblich, unwandelbar/unveränderlich, ewig wäre.
                       Das was das Ziel von allem ist, das Unendliche ist
                       unser eigenes SELBST.
                       Und um jenes SELBST zu erfahren, das die Grundlage                  
                       von allem ist, müssen wir nicht suchen, wir müssen
                       nicht herumsuchen, wir müssen keine Anstrengungen
                       machen; es ist überall gegenwärtig.
                       Woimmer man ist, in welchem Zeit- oder auch auch
                        Ortsbereich auch immer, ist jenes SELBST da -
                        woimmer wir sind zu welcher Zeit auch immer; wir
                        müssen nur unser Gewahrsein zu jener Ebene
                        bringen/hin ausdehnen und das ist alles.
                        Jenen Bereich des Lebens vergessen habend, suchen
                        wir nach jenem ewigen Glücklicksein.
                        Jenes SELBST ist, es ist Sein und es ist glückseelig.
                        Jenes vergessen habend, suchen wir jetzt danach.
                        Wir haben vergessen was wir selber sind und wir
                         sind damit beschäftigt zu versuchen, jenes in der
                         Welt zu finden.
                         Solange wir nicht zu jenem Bereich gelangen/ in
                          jenen Bereich - der unendliches Glücklichsein ist und
                          Freiheit von Leiden umfaßt - eintreten, werden wir  
                          nicht frei von Leiden sein, werden wir nicht
                          jenes ewige Glücklichsein erlangen.
                          Falls es irgendein Glück bedeutenderer Natur gab,
                          so war es so, daß die Kindheit irgendwann
                          vorbei war, die Jugend zuende ging, man alt wurde
                          und selbst dann erlangte man nicht
                          Erfülltheit/Wunschlosigkeit in dieser Welt.
                          Wenn man gefestigt ist im SELBST dann erreicht
                          man automatisch diese Freiheit von Leiden und
                          das Erlangthaben von Glückseeligkeit.         
Mr. Mahesh:     Das was Er jetzt sagt, ist nunmehr sehr wichtig:
Tat Wale Baba (Mahesh übersetzt weiter):
                          Er sagt, daß das was allgegenwärtig ist nicht
                          gedacht werden muß; es ist bereits da. Fange an zu
                          sein.
                          Das was allgegenwärtig ist, muß man nicht suchen.
                          Unsere Aufmerksamkeit/unser Gewahrsein muß nur
                          zu jener Ebene gebracht werden und jene
                          Glückseeligkeit ist da; man muß sie nicht suchen.
                          Wenn wir nicht in jene allgegenwärtige
                          Glückseeligkeit gelangen, werden wir nicht
                          Zufriedenheit erreichen. Falls sie kommen würde,
                          wäre sie durch all jene vielen Anstrengungen in der
                          Welt längst gekommen; aber sie ist nicht gekommen.
                          Deshalb ist euer eigenes Sein das was euer SELBST
                          ist ; man muß nicht in der Außenwelt danach
                          Ausschau halten.
                          Und es ist unabhängig von irgendeinem religiösen
                          Glauben; egal ob man ChristIn ist oder auch
                          MohamedanerIn oder auch Hindu. Jenes Sein ist das
                          Wissen selber; man muß es nur wissen.
                          All diese verschiedenen Manifestationen von
                          Glücklichsein, die wir in der Welt erfahren sind
                          auch die Manifestationen jenes gleichen ewigen
                          Seins, welches unser eigenes SELBST ist.
                          Falls wir des SELBSTs gewahr sind, wenn wir es
                          kennen ist es gut; andernfalls müssen wir es sein.
                          Und deshalb ist es nötig unsere Aufmerksamkeit/
                          unser Gewahrsein tief in unser eigenes Selbst zu
                          bringen. So tief wir unsere Aufmerksamkeit/unser
                         Gewahrsein zu unserem SELBST bringen können,
                         so intensiv können wir das, was allgegenwärtig ist, in
                         unserem täglichen Leben dabei haben.
                         Wenn wir jenes SELBST mal wissen, werden wir
                         ewig zufrieden sein; obgleich in der Welt bleibend,
                         werden wir Zufriedenheit leben.



Nachdem der Text anscheinend, je nach Browser oder auch Bildschirm, immer wieder zu verrutschen scheint, hier noch eine verrutschungsinvariante Form:


 





14) einige Ausführungen meinerseits:


a) Allgemeine Überlegungen:

Nunja, lt, Shankara, Vasishta etc ist diese Welt eine Art "Traum", "Samsara". Aufwachen aus diesem Traum heißt "Frieden" finden und hieße die "Wahrheit" über die Natur dieser Welt jenseits von Wachen,Träumen&Schlafen in "absolutem Bewußtsein" zu finden; das würde "richtige Meditation" leisten. (....Auch im Kleinod der Unterscheidung findet sich Etliches dazu und auch auf Seite 135 ein Kapitel titels "der Schüler erfährt Brahman"...)

Nachdem alles, was in dieser Welt vorkommt, auch im Traum erfahren werden kann, könnte - formal logischerweise - diese ganze Welt hier eine Art Traum sein.

Weil diese Welt eine Art Traum sein könnte (ich behaupte hier nicht "ist"!), so würde aus der "Existenz" von Leiden in dieser Welt nicht mehr auf die Nicht-Existenz Gottes geschlossen werden können: Gott wüßte ja gegebenenfalls die Natur dieser Welt als "Traumwelt" und müßte folglich gegen "Leiden" nichts unternehmen, obgleich Er/Sie/sie ja ihre Hilfe und Unterstützung würden abieten können.

Außerdem könnte es auch ein Gesetz des Karma geben, da es einerseits Folge der Taten eines Gottes/von GöttInnen sein könnte und andererseits man auch wiederkehrende Träume haben kann.

Der Tod in dieser Welt wäre letztlich nur ein Aufwachen. Erneute Träume wären "Wiedergeburt" in dieser Welt oder auch so einer Welt.

Offenbar  heißt "Diese Welt ist eine Art Traum" nicht "Tun&Lassen"-Können was man will, da es ja auch ein Gesetz des "Karma" inkl. Wiedergeburt geben könnte - also immer schön "yogisch-brav" leben. Manche meinen, sie müßten senkrechte Wände hochklettern, andere leben brav und bequemer. Solange "yogisch-brav" so "gut"-genug.

 Ebenso offensichtlich ist, daß es, wenn diese Welt eine Art Traum wäre, einen Ausweg aus dem Kreislauf von Geburt und Wiedergeburt geben könnte und der Ausweg im Erkennen der Wahrheit über die Natur dieser Welt (inklusive Gesetz des Karma,..)  bestünde.

Für jenes Finden der Wahrheit über die Natur dieser Welt bedürfte es eben auch einer "richtigen Meditation"; siehe auch obige Literaturangabe und zB die Zitate von Seite 67 und 98 aus Shankara's Kleinod der Unterscheidung.



b) "Überlegungen ad Kompatbilität von TM und Abendland:

 In den Betrachtungen über die Grundlagen der Philosophie, NIKOL-Verlag, ISBN 978-3-86820-327-1, führt René Descartes aus, wie Er sich bemühte zu "zweifelsfreiem Wissen" zu gelangen und sicherheitshalber alles wegließ, woran für Ihn auch nur im geringsten Grund zum Zweifel bestand. "Augen zu, Ohren zu,...", weil die Sinne Ihn täuschen könnten, was blieb? Er dachte noch. Im Gegensatz zur üblichen Aufassung, meine ich nicht, daß nun aus "möglichst viel denken, seine Schlußfolgerung "Ich bin" kam/käme, sondern, daß Er merkte, daß Er sich auch schon mal verrechnet hatte, absurden Gedanken angehangen hatte und so nahm Er Zuflucht zu "Ergo" (was folgt nun daraus noch?) und kam zum -zweifelsfreien - Ergebnis "ich bin"; "Cognito ergo sum" - "ich denke, also?, ich bin".

Nunja, wenn man scherzhaft weiter denkt und sich so vorstellt, wie Herr Descartes mit verschlossenen Augen und verstopften Ohren in seinem Morgenmantel in seinem Sessel sitzt, könnte man zu: "Cogito ergo sum, summ, summ,summ  Bienchen summt herum" gelangen und daß das Ohrenverstopfen nicht alle Geräusche auszuschließen vermochte und so käme man dann zu: "Achja, Bienchen ist offenbar auch" und, oje, was nun, was noch? Na klar Andere sind auch noch. In den Upanishaden findet man "Ich bin das, Du bist das, all dies ist das". Herr Descartes gab die Antwort auf die Frage, was jenes "bin" , jenes "sein" eigentlich sei, nicht, zumindest nicht sogleich. In den Upanishaden, aber auch bei Vasishta, Shankara und Anderen findet man als Antwort, daß es da was gäbe, woraus alles bestünde, alle Götter , alle irdischen Lebewesen, alle Dämonen, alle Engel und was, gemäß den Brahma-Sutras des Herrn Vyasa "erkennbar" wäre, nämlich jenes absolute Bewußtsein. Insofern sehe ich die Lehren der Herren Vasishta, insbesondere des Religionsphilosophen Shankara und Anderer alles Andere als "wesenfremd" zum Abendland an.

Interessanterweise schuf  Herr René Descartes, wie auch in zahlreichen Mathematik-Schulbüchern zu finden ist, die "analythische Geometrie" durch welche geometrische Vorstellungen auf "Zahlen-Gebilde" zurückgeführt wurde. Eine Fortentwicklung  der "analythische Geometrie" - welcher als Teilgebiet der Mathematik die sog. "lineare Algebra" zugehörig ist - ist die "lineare Optimierung".(...Einfache Beispiele und ein Verfahren für einfachste Fälle findet sich auch in etlichen Mathematik-Schulbüchern..) Die Aufgabenstellung der sog. "Spieltheorie" (2-Personen-Nullsummenspiel" ) läßt sich immer auf  eine Aufgabe der "linearen Optimierung" zurückführen. Die Aufgabenstellungen der sog. "Vektoroptimierung", wo es in Erweiterung der "Spieltheorie" um die Optimierung mehrere Ziele gleichzeitig geht, läßt sich - unter gewissen Vorraussetzungen - auf eine endliche Abfolge von Rechnungen mittels der Algorthimen der "linearen Optimierung" zurückführen, lehrte Prof.Dr. Behringer an der TU München.

Da ich schrieb, daß diese Welt eine Art "Traum" sein könnte, es Gott geben könnte, es ein Gesetz des Karma geben könnte, es Befreiung aus dem Kreislauf von Geburt und Wiedergeburt geben könnte, ist es offensichtlich, daß man, salopp ausgedrückt, nicht der Depp sein will, falls es Gott, Gesetz des Karma, Erleuchtung geben könnte bzw die Welt sich eines Tages - etwa nach etlichen Geburten und Wiedergeburten - völlig zweifelsfrei und wahrheitsgemäß als eine Art Traumwelt heraustellen sollte; andererseits will man selbstverständlich auch nicht der Depp sein, falls es Gott dann doch nicht geben sollte, Er,Sie,sie sehr anders sein sollte/~n, als man es sich vorstellte, vorstellen konnte, definierte, zu definieren vermochte, das Gesetz des Karma entweder gar nicht existiert oder aber auch eine Art "kosmischer Karma-Verwalter" eine Begnadigung für jene erteilen kann, die zuverlässig gelernt haben, in Harmonie mit den Geschöpfen und der Welt leben zu wollen und zu leben, usw.   

Mit welcher "Aufgabenstellung" hat man es da dann - abstrakt logisch,  mathematisch gesehen - zu tun? Nunja, man hat es mit einer Aufgabenstellung der "Vektoroptimierung" zu tun, da man mindestens 2 Ziele zu optimieren vor sich hat, nämlich Alltag und Gott oder aber auch Alltag, Gott, Ende des Kreislaufs von Geburt und Wiedergeburt (Erleuchtung), Wahrheit über die Natur dieser Welt, Gesetz des Karma.

Interessanterweise stelle ich  zweifelsfrei fest, daß René Deascartes's Philosophie und sein Beitrag zur Mathematik da harmonisch, perfekt zusammenwirken, um also auch die "Schlußfolgerungen" die "philosophischen Überlegungen/Schlußfolgerungen/Ergänzung derselben (...wie Analythische Gemometrie ergänzt um lineare Optimierung"...)  für den Alltag zweifeslfrei, wissenschaftlich-objektiv-sachlich bewältigen zu können.

(....Im Zusammenhang mit meiner Übersetzung von Gaudapada's Kaurika merkte ich bereits Folgendes an: >> René Descartes wies in seinen Überlegungen explizit daraufhin, daß der Geist unteilbar sei. - Siehe René Descartes, Betrachtungen über die Grundlagen der Philosophie, NIKOL, ISBN 978-3-86820-327-1. Auf  Seite 24 heißt es: "..Dieser Schluß wird in der sechsten Betrachtung gezogen und wird daselbst noch dadurch bestätigt, daß wir alle Körper als teilbar, den Geist dagegen oder die menschliche Seele nur als unteilbar auffassen. In der Tat können wir ja von keinem Geist eine Mitte vorstellen, wie wir es bei jedem noch so kleinen Körper können".....<<. Das ist durchaus sehr bedeutsam, da aus der "Unteilbarkeit des Geistes" leicht die Befürchtung aufkommen könnte, daß die "analythische Geometrie" untrennbar mit Subjektivitäten des René Descartes verbunden sei und man sozusagen in seinem "unteilbaren Geist" schließlich gefangen sei. Nun ist es aber so, daß die Mathematik zweifelsfrei nachweisen konnte, daß aus der Analythischen Geometrie logisch korrekt alle Aussagen der "euklidischen Geometrie" - wie sie  zB von Hrn. David Hilbert, allgemein akzeptierter Weise, in axiomatischer Form korrekt dargestellt werden konnte; siehe auch das Buch von Professor Effimov - geschlußfolgert werden können und umgekehrt. Diese Tatsache äquivalenter Darstellungen erweist jenes "mathematisch wahre Gebilde" als jenseits von Hilbert, jenseits von Descartes, jenseits von Euklid. Jene, Descartes, Hilbert, Euklid usw haben ein und dasselbe dargestellt, etwas was insofern nicht gebunden ist an Euklid, Descartes, Hilbert und sich mit Jenem zu befassen führt daher zu keiner Verstrickung in jene, die das darstellen. Insofern ist eben der Ansatz des Mr. Mahesh, demzufolge, er die Richtigkeit der TM-Lehre im Lichte der Bhagavad Gita, etc darzulegen hätte, sehr sinnvoll gewesen. Später versuchte Er es ja anhand der Veden selbst. indem Er Tat Wale Baba, Shankaracharya Shantanand wenigstens abundzu zu Wort kommen ließ, hat Er auch einen Beitrag in jene Richtung geleistet. Es ist sehr bedauerlich, daß Mr. Mahesh keine Übersetzung mit Kommentar zu allen Kapiteln der Bhagvad Gita vollenden konnte....)

Wenn da "Christen", deutsche Gerichte etc solche Probleme sahen, daß sie zu Maßnahmen der Verleumdung griffen, so frägt sich, woraus denn Ihr Gott besteht, der doch zweifeslfrei gewisse "Eigenschaften" habe und es auch eine Beziehung zwischen jenen Eigenschaften geben solle, da Er ja unsterblich wäre. Dürfte man etwa nicht zum zweifeslfreien Ergebnis gelangen, durch korrekte, natürliche, objektiv-sachlich ausgeübte Meditationspraxis, daß auch jener Gott - falls es Ihn tatsächlich als eigenständiges Wesen geben sollte bzw je gegeben haben sollte - nichts anderes ist als Brahman und zu Brahman in jener Beziehung steht wie ein" Ring zu Gold, Silber oder auch Kupfer, dh dem Material woraus er besteht", ein "Gefäß zum Ton woraus es gemacht ist"?              



c) Alltag und "Spiritueller Weg", inkl. "TM"

Interessant ist auch im Yogavasishta, Kapitel II, der Anfang der Unterweisung, [Die Geschichte von Suka], Seite 19-20; (,Die Lehren des Weisen Vasishta, Ansata-Verlag, ISBN3-7157-0112-9). 

Der große Gelehrte Vyasa unterrichtete seinen Sohn Suka zunächst selbst. Irgendwann schickte Er Suka für weitere oder auch zusätzliche Unterweisungen zu König Janaka und Suka ging zu König Janaka, seinem Vater vertrauend.

Dem gegenüber ist die Geschichte Ramas zu sehen, der als 16-Jähriger sich auf eine Pilgerreise begab, dann mit "Total-absolut-0-Bock"-Stimmung zurückkehrte, nichts mehr aß, nur noch in seinem Zimmer saß, usw. Es bedurfte vieler Zufälligkeiten, daß Er überhaupt überlebte: Vishwamitra kam - zufällig oder auch absichtlicher oder auch intuitiv oder auch...... - des Weges und befand, daß Rama nicht krank sei sondern nur der richtigen Belehrung bedürfte (was zB die "moderne" Psychiatrie schon nicht mal zu begreifen vermag, sodaß heutzutage solch ein "Zustand" ziemlich zwangsläufig zu schweren Misshandlungen durch den deutschen Staat per "seiner" Psychiatrie - zumindest in Deutschland - führte); Rishi Vasishta, der Hofweise, lebte zufälligerweise - oder auch absichtlich -  zu jener Zeit und wurde ausgewählt, jene Belehrung zu übernehmen.

Das Yogavasishta stellt also jenen geordneten, wohlbehüteten, zielstrebigen Weg des Suka dem chaotisch verlaufenden, problemebeladenen Weg des Rama gegenüber. Offenbar ist Suka's Weg das "Vorzuziehende"; Rama's Weg ist so ähnlich wie keine Elementarschadensversicherung für ein Haus zu haben und wenn es bei einem Erdbeben zerstört wurde, fängt man an Lotto zu spielen und erwartet, daß man nun aus karmischen, religiösen, sozialstellungsbedingten oder auch sonstigen Gründen sicher gewinnen werde. Ein Anderer schloß jene Versicherung mit Erwerb des Hauses ab, zahlte regelmäßig einen relativ geringen Betrag und "gewann" nach dem Erdbeben bei jener "Art von kluger Lotterie" sicher, das was Er zum Wiederaufbau benötigte.

Interessanterweise verstand es Herr Vasishta, Rama zu helfen. Gar erstaunlich sind solche "Hilfen".

Allgemein sei bzgl. "Hilfen" noch folgendes bemerkt: Ein über 80-jähriger Vater und Kollege erzählte mir mal folgende Geschichte: Sein Sohn war auf Drogen; die Terroristenclique Baader-Meinhof  waren außer TerroristInnen auch Drogenjunkies; in jener Drogenclique der Baader-Meinhof-Bande war nun auch sein Sohn gewesen, als man Andreas Baader und Ulrike Meinhof, die sich gerade mal wieder mit Drogen vollgepumpt hatten, in einem alleinstehenden Haus im Speicher oben verhaftete. Sein Sohn, der nicht zu den Terroristen gehörte kam in die geschlossene Psychiatrie wegen seiner Drogensucht. Eines Tages kam der behandelende Arzt und Psychiater zum Vater und sagte: "Ihrem Sohn kann kein Mensch mehr helfen; wir vermögen nicht mehr in seine Welt vorzudringen. Wenn Ihm überhaupt jemand helfen kann, dann ein Tier, evtl ein Hund. Ein Boxer wurde für besonders geeignet befunden und Er schaffte was kein Facharzt, kein Richter, kein Anwalt, nicht der Vater, keine Menschen-Freunde vermochten; er drang in dessen Welt vor und brachte ihn heil zurück, wo Er dann ein normales Leben zu leben vermochte; allerdings blieb es die Aufgabe jenes Vaters, sich um den Herrn Hund, den Boxer zu kümmern.

So ist es alles andere als selbstverständlich, daß Rishi Vasishta dem jungen Prinzen Rama zu helfen vermochte; interessant ist auch welche Vielzahl von schier unglaublichen Geschichten Herr Vasishta - ua jene von der unsterblichen Krähe Busunda, dem Dämon Prahlada, usw - der Hofweise Rishi Vasishta dazu aufbot.

Offen bleibt dabei zunächst  dann die Frage nach dem wie man einen geeigneten "Lehrer für solche Themen" von einem Ungeeigneten, der einen am Ende auf so eine "Pilgerreise alà jener verhängnisvollen des Prinzen Rama" schickte, auszuwählen in der Lage sein sollte. Dabei könnte man argumentieren, daß die Übereinstimmung mit den Erfordernissen eines gut-möglichen Alltagslebens, ein wichtiges Kriterium sein könnte; ebenso sind natürliche Meditationsübungen - ohne Gewalt gegen sich - sicherlich sicherer. Gegen außer Schlafen-Wachen-Träumen, sich auch in natürlicher, anstrengungsloser Weise in Richtung tiefer Ruhe zu bewegen (vgl Ausführung von Shankaracharya Shantanda) und sei es unter Zuhilfenahme eines "Wortes ohne Bedeutung", eines traditionellen Mantras, kann kaum was eingewendet werden, sofern es in einem geeigneten zeitlichen Rahmen bleibt. Aber dieser Frage wird man sich genauer zu widmen haben; auch hier kann "Entscheidungstheorie" eine gewisse hilfreiche Rolle spielen und sollte einen vor "völlig falscher Richtung" - mehr könne man eh nicht erwarten, schrieb ein Professor im Vorwort zu seinem Buch ad Entscheidungsstheorie -  bewahren können.

Auch die Bhagavad Gita beschreibt jenes Problem, das im Zusammenhang mit einem Bemühen um Spritualität, Erleuchtung entstehen könnte: Arjuna, jener Krieger, war plötzlich - als der Gegner bereits zum Angriff blies - unfähig zu handeln und war wie gelähmt, hilflos dem Widerstreit seiner Gefühle, Ideen, Überlegungen ausgesetzt. Auch in seinem Falle fand sich zufälligerweise jemand, der kompetent war, Ihm rechtzeitig zu helfen. Aber es würde zweifelsohne völlig absurd sein , sich "einfach d'rauflos auf sprituelle Abenteuerwege" einzulassen/zu begeben auf der Basis des Glaubens oder auch "Versprechens dubioser Personen", es werde dann jemand kommen, Ihm/Ihr zu helfen, so wie Rama und Arjuna geholfen worden sei. Die entscheidungstheoretisch sinnvolle Überlegung anläßlich jener klassischen Schriften und "Probleme", ist, daß man sich vorher einen strategisch vernünftigen Weg zu suchen habe und der nächstbeste, nicht unbedingt - eher selten - ein tauglicher geschweige denn der geeignetste wäre. Es gilt eben Alltagseerfordernissen und spirituellem Streben im Sinne von Vektoroptimierung optimal gerecht zu werden.

Es ist offensichtlich, daß es keinen  Sinn ergeben konnte, wenn man in einem unreifen und unmündigen Staat, wie es Deutschland anno 1971 nach der NAZI-Schreckensherrschaft immer noch gewesen war, einen Minderjährigen einfach nötigte sowas wie TM zu erlernen, vorbei an den Rechten und Ansichten der Erziehungsberechtigten usw und sich dabei stets nur darauf verließ, daß da gar nichts dabei passieren könne, was nicht eh passiere sollte. Da waren Ärger bis hin zu Verfolgung dann vorprogrammiert.





d) Ad Streit zwischen TM-Vereine in Deutschland und der Bundesregierung bzw Deutschland's Umgang mit der "TM" und "TM-Scene":

Es kann nicht hingenommen werden und bedarf der ausdrücklichen Kritik, daß irgendwelche Sektenbeauftragte von r.-kath. oder auch ev.-luth. Kirche, irgendeine "C-DU"-Regierung dann irgendwann anfingen all diese zahlreichen wissenschaftlichen, von ProfessorInnen als zumindest ausreichend beurteilten Untersuchungen betreffs TM, als "Betrügereien", "Lügen", "Absurditäten" etc vom Tisch zu wischen zu versuchen. Hat die Bundesregierung, die TM runter machte, auch nur eine einzige wissenschaftliche Publikation, annährend vergleichbar zur Ph.D-Arbeit von Keith Wallace etc vorlegen können, welche eine "Gefährlichkeit der TM-Meditatonsübung" nachwies? - Mir ist keine einzige bekannt und man konnte mir, als ich mir mal einen Tag Zeit nahm, solches anzuhören, keinen einzige nennen: weder in einem großen Klinikum (wo doch TM angeblich so gefährlich sei; da wüßte man in einem großen Klinikum gar nichts Genaueres dazu?), noch bei einer Uni, noch beim Bay. Kultusmininisterium, noch vom Sektenbeauftragte der r.-kath. Kirche konnte man  mir eine solche Untersuchung vorlegen. Hingegen begegnete man mir mit Gewaltätigkeit, Lügen usw.  Was von sog. "Gutachten" irgendwelcher PsychiaterInnen zu halten ist, erklären folgende wahre Begebenheiten: a) Ein geldhabender Mann ermordete seine Tochter  mit 19 Messerstichen; nach der ca Hälfte seiner Stiche war das Messer abgebrochen und Er ging in die Küche, holte ein neues Messer und machte weiter. Er wurde verhaftet, kam in eine geschlossene psychiatrische Einrichtung. Ein Psychiater erklärte Ihn für "psychostisch" etc und dem Staatsanwalt waren nun die Hände gebunden. Nach 1 Jahr war die Frist, Anklage wegen Mordes erheben zu können, dem Staatsanwalt davongelaufen und nun kam eilends ein zweiter psychiatrischer Gutachter und entschied, daß das erste psychiatrische Gutachten falsch gewesen sei. Nun wurde der Mörder auf freien Fuß gesetzt. Vom Tod seiner Tochter profitiert/~e er dahingehend, daß sie ihren Pflichtteil sich nicht mehr auszahlen lassen konnte, keine Schadensersatzklage gegen Ihn mehr führen konnte usw usf.  Eine andere Geschichte ist Folgende:  b) Ein Mann war wegen wiederholter Vergewaltigung udgl verurteilt worden. Eines Tages kam die, jenen Straftäter "betreut" gehabt habende, Psychiaterin zum zuständigen Beamten und verlangte die Freilassung ihres "Patienten". Der Beamte weigerte sich jedoch und verwies auf die lange Vorstrafenliste. Daraufhin schrieb sie das "nötige" Gutachten und der Mann wurde auf freien Fuß gesetzt. Weil er ja angeblich im Verlauf jener psychiatrischen Behandlung etwas dazu gelernt habe, vergewaltigte Er dieses mal nicht "nur", nein, diesesmal ermordete Er sein Opfer anschließend auch noch.

Zweifelsohne wäre es für den deutschen Staat ein relativ Leichtes, die Statistiken ad "Erwerbslosigkieit", "Hartz-IV-Fall-Geworden", "Verarmung" etc von TM'lerInnen mit einem repräsentativen Bundesquerschnitt zu vergleichen. So würden sinnvolle, nützliche Ergebnisse, die eventuell für die TM-Vereine im Ergebnis gar nicht schmeichelhaft gewesen sein könnten, erlangbar gewesen sein. Aber willkürliches für Verrückterklären, bestehendes fachärztliches Gutachten zugunsten eines TM'lers durch ein nicht-vorhandenes Guachten zu ersetzen, sich dabei auf einen Antrag eines einfachen Arztes zu berufen, der nochdazu in einem Gutachten für interne Zwecke haufenweise Fakten verdrehte, vorgegebene Formblätter wahrheitswirdrig ausfüllen udgl, das kann man nur als Verfolgung bezeichnen und hat mit Rechtsstaatlichkeit, Würde, Freiheit, Gerechtigkeit ebenso wenig zu tun wie mit Wissenschaftlichkeit, Seriösität usw.

Hinzukomt, daß Pschyiatrie nunmal von der Lehre her "materialistisch" ist: Bewußtsein wäre die Folge eines funktionierenden menschlichen Gehirns, glaubt bzw dogmatistiert man da. Vonseiten der vedischen Tradition hingegen geht man davon aus, daß es ein aus sich selbst heraus existentes unendliches, zeitloses absolutes Bewußtsein gebe, woraus dieses Weltall und alles was dazu gehört, entstanden sei. Es kann  nicht hingenommen werden und bedarf der ausdrücklichen Kritik, daß "Psychiatrie" es nie&nimmer zustehen kann und darf, per "psyschiatrischen Gutachten" den eigenen "Materialismus" für das "Alleinseeligmachende", alles Andere für "geistesgestört" zu erklären, als Solches zu verkünden und dumme Gerichte erklären das dann zur Wahrheit schlechthin. Na klar, darf eine spezielle Bundesregierung aus atheiistischen MitgliederInnen bestehen; das ist nicht auszuschließen; ebenso könnte es mal lauter "Materialismus-AnhängerInnen" sein; aber es steht ihnen im Rahmen der freiheitlichen demokratoischen Grundordnung nach 1945 nie&nimmer zu, den "spirituellen Standpunkt" für "falsch", "hoch-gefährlich" odgl zu erklären; die private Meinung einzelnener RegierungsmitgliederInnen ist deren Meinung; sie kann aber keine Regierungsmeinung sein!

Allerdings besteht sehr wohl eine allgemeine Gefahr, wenn jemand so loslegt, wie es Mr. Mahesh getan hatte: Ohne fertiges Lehrgebäude, ohne konkrete Ausbildung dafür, entgegen des Rates von jemand, der er selber für kompetent hielt, einfach "TM-Lehren" anfangen, das war schon hoch-riskant und da nahm Er schon viel Unheil billigend in Kauf. Das darf und sollte man schon - auch als Bundesregierung, Kirche etc - sagen; aber man muß dann schon sachlich korrekt argumentieren und das kritisieren, was zu kritisieren ist. "TM-Vereins-Gebilde" und "TM selber" einfach in einen Topf geworfen zu haben, kann nur als Unverschämtheit, illegal und Vor-1945-Un-Stil bezeichnet werden.

Durchaus gilt ad Kritik vonseiten der Kirchen einzuwenden, daß ihr Jesus Christus bekanntermaßen bzw von den Kirchen selber eingeräumtermaßen im Zusammenhang mit einem ebenfalls unreifen, unmündigen Staatsgebilde, wie es das römische Schreckensreich nunmal auch war, schlimmes Unheil, schlimme Verfolgung über viele "AnhängerInnen" brachte. Aber TM'ler der Verfolgung auszuliefern - per unsachgemäßer Kritik, falscher Bezichtigungen, "falschem Zeugnis wieder den Nächsten" etc - und dann mit "christlichem Märtyrer-Denken" zu kommen und so den, zu Opfern gemachten, TM'lerInnen, das Christentum "hautnah erlebbar zu machen zu unternehmen versucht/unternommen zu haben" war und  ist absurd. Es kann auch nicht hingenommen werden, wenn Sektenbeauftragte sich in die TM-Center begaben, um dort für ihre Kirchen zu "missionieren". Nachdem wie ich deren aggressives, verleumderisches Auftreten 1976 erlebte erübrigten sich deren Vorstellungen/Verständnnisse von der christlichen Religion ohnehin.


Es gab bei deutschen Ministern bisweilen das Problem, daß sie das Minister-Briefpapier missbrauchten, um Empfehlungsschreiben für eine privat bevorzugte Firma oder auch die Firma eines Freundes zu verfassen, die einer Werbung für jene Firma entsprechend, dann eingestuft wurden. Das offizielle Bundesregierungsbriefpapier missbraucht zu haben, um eine "Empfehlung" gegen Jemand herauszugeben, kann nicht als etwas Anderes verstanden werden. Die Darstellung von Meditation von Swami Shantanand Saraswati und die Darstellungen des Mr. Mahesh - etwa in seinem Buch "Die Wissenschaft vom Sein und Kunst des Lebens" unterscheiden sich - außer das Swami Shantanand Saraswati wohl die schönere und bessere Darstellung gab - kaum. Man muß allerdings im Zusammenhang mit Mr. Mahesh noch berücksichtigen, daß seine Anweisungen bzgl des Umgangs mit Gedanken während einer Meditations-Sitzung erst im Rahmen des "Kurses zur Erlernung der TM" nach der Initiation gegeben werden. Swami Shantanda Saraswati betrieb da offenbar wesentlich weniger Geheimniskrämerei. Nichtsdestoweniger sind die Anweisungen im Rahmen eines Kurses zur Erlernung  von TM von jenen, von Swami Shantanand Saraswati dargelegten Ausführungen, nicht grundsätzlich verschieden. Welche Mantren Swami Shantanand Saraswati weiterzugeben/zu benutzen pflegte, weiß ich nicht; ich weiß auch nicht, was Er von den von Mr. Mahesh "benutzten" Mantren hielt. Allerdings haben sich die "TM-Mantren" als klassische Mantren herausgestellt, sodaß ihnen "Destruktivität" oder auch "Gefährlichkeit" nachzusagen nur als sowas wie Diskriminierung, anti-indische Agitation verstanden werden kann. Die TM-Organisationen sind etwas anders als die "TM-Meditations-Technik", dh etwas anderes als die "transzendentale Meditation" und wenn die Bundesregierung die "Transzendentale Meditation" - erst als destruktive und dann - als "gefährliche Sekte" einstufte, so war das schlichtweg eine Unverschämtheit und von so einem Missbrauch von Bundesregierungsbriefbögen nicht mehr zu unterscheiden. Es war allerdings auch eine Unverschämtheit vonseiten des Mr. Mahesh jene SRM udgl aufgelöst zu haben und lediglich jene "Monarachie nachempfundene" "komisch-dubiose" Organisation eingeführt zu haben. Nunja, wenn jemand TM im Rahmen von sowas wie einer "Heils-Monarchie" (vgl. jene "Sekte "Heilsarmee") lernen bzw lehren will, na bitte, solange jene Organisation im Rahmen der Gesetze der freiheitlicher demokratischen Grundordnung bleibt. Aber es sollte nicht nur, sondern es müßte schon auch noch zusätzlich jene SRM weitergeben, wobei jene SRM vom organisatorischen her zweifelsohne ja auch Verbesserungsbedarf hatte.

Es ist sicherlich richtig, daß von der Regierung des Dr. Kohl, die gekennzeichnet war durch die Spendenaffaire (siehe ua Doku im SRW, ca Januar 2018), sich systematischen Lügens (Der jetzige Bundestagspräsident und langjährige Finanzminister Dr. Schäuble sagte sowas; er sagte, daß es keine Spender gegeben habe, denen Dr. Kohl sein" Ehrenwort" gegeben gehabt habe; es sei hingegen ein System schwarzer Kassen gewesen.) bediente, auch bzgl. deren Aussagen betreffs "TM" nicht viel zu halten sein kann. Anbetung des "Mammon" ist das Eine, ein System schwarzer Kassen unterhalten (...nochdazu als Bundeskanzler und CDU-Vorsitzender, Vorsitzender einer Partei, die sich als "christlich" verstanden wissen will...) und insofern auch noch "schwarze Magie" betreiben und "dem Mamon" sowas wie "schwarze Messen abhalten" ist noch etwas anderes. Auch insofern hatte Dr. Kohl und seine Regierung nicht die not-wendige Wissenschaftlichkeit, Bereitschaft zu Objektivität, fairem Umgang udgl. in Sachen "TM". Insofern kann es nicht verwundern, wenn ich so relativ leicht klare, krasse Mängel, Unterlassungen, Widersprüchlichkeiten und Falschheiten in jenen "verbreiteten Auffassungen" jener deutschen Bundesregierung finden konnte und sie als "falsches Zeugnis wider den Nächsten" enttarnen konnte.




15)  Einige von Mr. Mahesh's Ansätzen zu jener Thematik:

Die Behauptung des Mr. Mahesh war, daß "TM" so eine "richtige, brauchbare Meditationsübung" sein würde. In seinen Kommentaren zur Bhagavad Gita versuchte Er das damit zu "beweisen", daß Er aufzeigen wollte, daß seine Lehre allen Lehren der Bhagavad Gita - dh jenen Lehren, die in jenem Epos Krishna zugeschrieben werden - gerecht werde.

In einem "Widerspruchsbeweis-Verfahren" kommt jedoch der Widerspruch am Ende. Nun hat es Mr. Mahesh offenbar nicht geschafft auch die letzten 2 Kapitel der Bhagavad Gita zu kommentieren und so blieb Er jenen "Beweis" nunmal schuldig. Eigenartig, daß Ihm stets irgendwas Anderes immer wichtiger war; als Physiker hatte Er Mathematikvorlesungen zu hören gehabt und jene "indirekte Beweismethode" müßte Ihm geläufig gewesen sein. Angenommen "TM wäre ein Schmarrn, dann könnten doch die Erfahrungen etc nicht so gut passen zu Vers sowieso und Vers sowieso und mit Kapitel 1, 2,3,,,, "auf die Reihe" gebracht werden können.

Nunja, aber der Widerspruch wäre dann ja eh sehr zum Ende hin gekommen und vor jenen Kapitel drückte sich Mr. Mahesh defacto nunmal oder aber auch es war so, daß Er es einfach nicht schaffte seinen "Beweis-Versuch"  zu Ende zu bringen; sei es wie es sei: Schade; er hatte sich zweifelsohne viel Mühe gemacht.

(siehe auch meine Amazon-Rezension: https://www.amazon.de/product-reviews/3933496411/ref=cm_cr_dp_synop?ie=UTF8&reviewerType=all_reviews&showViewpoints=0&sortBy=recent#R9VJS3BRXE688 ; allerdings war ich in wenigen Punkten ungenau: Ob nun Draupadi Schwester oder Ehefrau von Judishtira - dem Älltesten der 5 Pandavas - war, spielt keine wesentliche Rolle. Der Hinweis auf die Kolonialzeit meint die Nähe zu jener Zeit, die im Leben von Mr. Mahesh während des Studiums etc zweifeslohne eine bedeutende, evtl wenig erfreuliche Rolle spielte (Swami Swaroopananda, Shri Aurobindo sind/waren 2 prominente Lehrer im Zusammenhang mit Veden, Vedanta, Yoga, Bhgavd Gita udgl, die beide mit der Kolonialmacht aneinandergeraten waren; Mr. Mahesh wäre also keinesfalls der Einzige gewesen, dem der Kolonialstatus Indiens damals großes bis sehr großes Unbehangen bereitete oder gar Konflikte beschert hatte. Indien erlangte seine Unabhängigkeit von Groß Britanien am 15. August 1947. Swami Brahmanda Saraswati war 1940 Shankaracharya geworden und Mr. Mahesh hatte Ihn  voher noch gefragt, ob Er dessen Schüler werden dürfe, aber jener sagte zu Ihm, daß Er erst sein Studium beenden solle (Genaueres siehe Mr Mahesh&TM in English oder auch Mr Mahesh&TM auf Deutsch ; so wird Mr. Mahesh ca 1941/42 , spätestens sicherlich 1945 zu Swami Brahmanda Saraswati gekommen sein und zu jenem Zeitpunkt war Indien noch Kolonie, sodaß die Kolonialzeit also auch da noch hereinspielte.)


Interessant sind zu üblichen Darstellungen von TM in jenem "1. Informationsvortrag" auch in den Shivasutren die Verse 6 - 12; es werden Wachen, Träumen und Schlafen dargelegt und daß es noch einen vierten Bewußtseinszustand, Turiya gäbe. In den "TM-Info-Vorträgen" wurde dargelegt, daß es eben Wachen, Träumen, Schlafen einerseits gäbe, Schlaf gewisse Spannungen auflösen könne; es aber daraüber hinaus noch jenes "transzendentale Bewußtsein"", reines Bewußtsein"gäbe, wodurch sich auch tiefer liegende Spannungen abbauen würden. In seinem Buch "Die Wissenschaft vom Sein und Kunst des Lebens" geht Mr. Mahesh sehr pointiert auf eben diese Themen ein. Er schreibt über "Reines Bewußtsein", über sein "Wissen"/seine Vorstellungen ad "richtige Meditation" und aber auch über die Möglichkeit "reines Bewußtsein" und "Alltag" zu einem harmonischen, normalen, gesunden Ganzen zu integrieren. In meiner Rezension zu "Wissenschaft vom Sein und Kunst des Seins" bei amazon, ging ich darauf etwas ein. Das entscheidede Problem bei Mr. Mahesh's Lehre besteht, meines Erachtens, darin, daß Er später dann mal per Tonband seine TM-Lehrer in einem - durchaus sehr interessanten - Vortrag über die Patanjali Yogasutren darauf hinwies, daß seines Erachtens die yogische Prinzipien "Yama, niyama,... samadhi" nicht hintereinander praktiziert werden müßten, sondern es sich wie mit einem Tisch mit 8 Beinen verhalten: Zieht man an einem Tischbein, kommen die andere und er ganze Tisch auch daher. Das müßten TM-Ausübende eben   v o r h e r   wissen, da ein "Mehr" an ahimsa (Gewaltlosigkeit, vgl etwas Mahatma Gandhi), Nicht-Heftigkeit udgl erhebliche Auswirkungen auf  einen Lebensweg haben würden können. Sicherlich wären es positive Auswirkungen; aber wenn man das eben vorher nicht dazu sagt, wirkt jene "Meditationsübung" dann plötzlich als wie ein "kriegerischer Angriff". Plötzlich tauchen "subjektive Konflikte" auf, zwischen dem Anspruch des Alltags und dem "Heraufbeschworenhaben von mehr ahimsa & co per TM-Ausübung". Na klar, nachdem es sich um eine "natürliche Meditationsübung" handelt und sie auch als gewaltfreie, mühelose Meditationspraxis dargelegt wird, könnte es durchaus so sein, daß eben nicht "mehr Ahimsa" und damit nicht mehr dauerhafte Integriertheit von transzendentalem Bewußtsein daraus werden könne, als der Einzelne zuläßt. Dennoch gibt es Situationen, etwa bei der Berufswahl, der Studienwahl, selbst bei der Partnerwahl etc, wo man bei abstrakt-intellektueller Inbetrachtziehung jenes "man zieht an einem Tischbein und der Rest kommt gleich mit" vernünftigerweise, vorteilhafterweise für "Wohlstand" etc, sich dann anderweitig entschieden haben würde und das wird va dann krass, wenn man das auch hätte können und wollen. Wegen jenes "evtl kommt eben auch ahimsa & co" daher, würde man sich einem "strategischen Problem" gegenübersehen und würde sinnvollerweise seine Beziehung zu yama, niyama,  ahimsa, aparigraha, brahmchary, etc vorher intellektuell, abstrakt klären. Ein Soldat würde seine Aufgabe ohne eine "gewisse Heftigkeit" wohl bisweilen nicht bewältigen können und wenn es Ihm dann im Einsatz so erginge wie dereinst Arjuna (Mahabarata/Bhagvad Gita oder auch - analog - Rama (Ramayana von Valmiki, Yogavasishta), wäre das eher sein sicherer Tod und wenn's blöd liefe auch noch der Tod seiner KameradInnen, wenn nicht gar das Ende seiner Einheit. Sowas dürfte man aber einfach nicht riskieren und müßte eben vorab zuverlässig geklärt worden sein.



Zweifelsohne war Mr. Mahesh so ab ca 1970 bis ca 1976 sehr bemüht um "Wissenschaftlichkieit" und insofern wäre jenes Thema mit Ihm wohl besprechbar gewesen; es war aber - trotz MIU, Maharishi International University, Fairfield Iowa, USA  - nicht geschehen; andere, die dazu sich die Fähigkeit zu erwerben fähig und bereit waren, wurden behindert, weil am es vorab eben nicht darlegen hatte können.

Ich behaupte hier nicht, daß TM eine untaugliche, gefährliche Meditationsübung sei. Aber in den vorbereitenden Vorträgen fehlt leider Grundlegendes.

So müßte auch im Rahmen des konkreten Initiationskurses der sog. "1. Tag Checking" am Abend des selben Tags der Initiation abgehalten werden und noch bevor die Neu-Initiierten erstmals selber meditieren.

Organisatorische Aspekte, Minderjährige usw sind dann wieder ein andere Themen. Aus einem 400.-€ Wochenend-Job in einer DAV-Kletteranlage weiß ich, daß man eine vernünftige, unschwer praktikable Zutritts-Kontrolle betreffs "Minderjähriger" sehr wohl hinbekommen kann (s. Orga Sport GmbH damals im DAV-Kletterzentrum in München), wenn man es ernst nimmt. Träger jener DAV-Anlage war damals auch ein Verein, kurz "der Trägerverein". Allerdings war das dort damals dann von einem Profi, einem Diplomverwaltungsfachwirt (FH) für jenen Trägerverein und später dann im Rahmen von Orga Sport GmbH - einem Team aus einem Diplomsportlehrer, Diplom-"Sportmanager", und eben jenem Diplom-Verwaltungsfachwirt (FH) gemacht worden. Die "TM-Scene" würde jenes wirksame und dennoch nicht sehr komplizierte System sehr wohl mittels geeigneter Fachleute aus den eigenen Reihen oder aber beauftragten Profis in den späten 60-er bzw frühen 70-er Jahren hinbekommen haben können; es erforderte keinerlei Computer (... auch wenn man es später auf ein Computersystem übertragen konnte...) odgl.


Der Anspruch von Keith Wallace in seiner PhdD-Thesis bzgl "Entdeckung eines vierten Hauptbewußtseinszustand" ist sehr fragwürdig, da es ua die Shivasutren (siehe etwa auch  Shiva sutras with meaning - Shaivam.org,

>> 1-7 Even during waking, sleep, and deep sleep one can experience the fourth state (transcending consciousness). <<

...den vierten Zustand (transzendierendes Bewußtsein)... (Von mir übersetzt, Schul-Englisch, über 8 Schuljahre hinweg als eines der Hauptfächer gehabt.)


>> *1- Universal consciousness

1-1 Consciousness is the self.                                         das Selbst ist Bewußtsein           
1-2 (Ordinary) knowledge consists of associations.       (gewöhnliches) Wissen besteht                                                                                              aus Assoziationen, Beziehungen                                                                                           zwischen  Gedanken bzw                                                                                                     gedanklichen Inhalten                 
1-3 Sets of axioms generate structures.                           Per Mengen von Axiomen                                                                                                    werden Strukturen geschaffen     
1-4 The ground of knowledge is mat\drka.                    Die Grundlage von Wissen ist                                                                                                mat/drka                                       
1-5 The upsurge (of consciousness) is Bhairava.
1-6 By union with the energy centers one withdraws from the universe.                                                             Durch Einheit, Vereinigung mit den Zentren der                                                                 Energie zieht man sich vom Universum zurück       
1-7 Even during waking, sleep, and deep sleep one can experience  the fourth state (transcending consciousness).

                                                  Selbst während dem Wachen, Schlafen und                                                                         Tiefschlaf kann die Erfahrungen des vierten                                                                        Zustandes machen   (transzendierendes,                                                                               überschreitendes Bewußtsein, absolutes Bewußtsein)       
 
1-8 (Sensory) knowledge is obtained in the waking state.                                                                                     Im Wachzustand wird Wissen gewonnen,                                                                              das auf Sinneswahrnehmungen beruht 
1-9 Dreaming is free ranging of thoughts.          Träumen ist ein freies Spiel                                                                                                    von Gedanken.
1-10 Deep sleep is maya, the irrational     .        Tiefschlaf ist Maya, das irrationale
1-11 The experiencer of the three states is the lord of the senses. <<                                                                       Der Erfahrende dieser 3 Zustände ist der                                                                               Herr der Sinne.

usw usf )


shaivam.org/ssshivasuutra.htm


oder auch bei: http://www.svabhinava.org/abhinava/ShaivaTexts/ShivaSutraLakshmanJoo-frame.php

(... Eine Übersetzung aus der Zeit von vor 1960 suche ich bei Gelegenheit noch; es gibt sowas aus dem Jahre ca 1920...)


Andererseits deckt sich die "Darlegung" dessen worum es bei "Transzendentaler Meditation" wie sie, lt. Mr Mahesh Prassad Varma, der Shankaracharya des Nordens von 1940 bis 1953, Swami Brahmanda Saraswati gelehrt habe, durchaus mit klassischen Yoga-Texten. Lediglich sind bei der Bhagavad Gita und im Yogavasishta solche "Problemfälle" (Konflikt zwischen Erleuchtungsstreben und Alltag) an den Anfang gestellt und werden also auch von Anfang an in Betracht gezogen. Dabei ist die Darlegung der sicheren Erwerbbarkeit des notwendigen Wissens dann letztlich ein Beweis dafür, daß man eben niemanden im Namen von "Meditation", "Erleuchtung" & co in solche Konfliktsituationen zu bringen habe, ja eben seriöserweise nicht dürfe.

Ok, Mr. Mahesh schrieb nunmal jene Neuübersetzung mit Kommentar zur Bhagvad Gita und als Pinguin Taschenbuch (auf Englisch; die erste deutsche Übersetzuung erschien erst 1972 ) kam das auch relativ früh heraus; es genügen dann auch durchaus die ersten 6 Kapitel, um jene Problematik angesprochen zu haben. Allerdings halte ich es für absurd, daß jener "Zustand von Hilflosigkeit" des Arjuna, als Folge von erheblichen strategischen Mängeln (Teilnahme an jenem Würfelspiel worüber das Mahabarata vor dem "Bhagvad Gita"-Kapitel berichtet) auch noch als "positiv" dargelegt wird und Mr. Mahesh so weit ging von einem "Yoga der Verzweiflung" zu sprechen. Duryodhana und die 5 Pandavas waren beide gleich blöd, die einen verspielten ihr Königreich und die Freiheit bei einem Würfelspiel und Duryodhana veranstaltete jenen Irrsinn, spielte angeblich noch falsch.

Künstlerisch dargestellt  wurde mal ein Ausschnitt im Volkstheater München: „Tage der Dunkelheit“ – Arbeit am indischen Urepos „Mahabharata“ - inszeniert vom indischen Regisseur Sankar Venkateswaran; folgende Pressebilder der Fotografin Gabriela Neeb geben einen Eindruck; dargestellt wurde der letzte Tag der Entscheidungsschlacht im Krieg zwischen den Karavas und Pandavas; es wurde va aus der Sicht der Königin, der Frau des blinden Königs Dhritarashtra, der Mutter von Duryodhana - gespielt von Frau Magdalena Wiedenhofer - dargestellt; von einem der Anhänger Duryodhanas wird auch Krishna dabei kräftig beschimpft (was nichts half) und es endet mit dem Tod von Duryodhana:

 

Pressebilder von Fotografin Gabriela Neeb, © Gabriela Neeb

...)
Erst verloren die Pandavas Freiheit und Königreich und dann verlor Duryodhana seine Freiheit und sein Königreich - beide per seinem Tod im Krieg mit den Pandavas -; Offensichtlich waren also beide gleich unwissend, gleich blöd. Statt also da anzusetzen und auf den strategischen Irrsinn, einer simplen Ungebildetheit der Kontrahenten einzugehen (...die Grundidee von Spieltheorie und das erste Beispiel etwa in der Vorlesung von Prof Behringer "Eis-Regenschirm"...) würde bereits genügt haben, um die Idiotie der Teilnahme an jenem Würfelspiel klar zu machen. Vernünftigerweise würde man also erstmal jenes grundlegende strategische Know How bereitstellen, um  solchen Irrsinn  mit derart schlimmen Folgen wie dereinst, vermeiden zu helfen. Dann könnte man auf die Thematik der Erleuchtung, Gott & co, Meditation eingehen und gegebenfalls einen wirklich wissenschaftlich-seriösen, sicheren Weg anbieten. Im Statistik Buch von Ulirch Kockelkorn, Sprinter Spektrum, ISBN978-3-8274-2294-1 wird darauf eingegangen wie "bedingte Wahrscheinlichkeit" und das Minmax-Prinzip der "Spieltheorie" (, genauer gesagt: "2-Personen-0-Summenspiel") zusammenhängen.

(....Na klar es geht um mehrere Ziele gleichzeitig, die zu "optimieren" sind/wären: zumindest schon mal Alltag aber eben auch um Erleuchtung; in Wirklichkeit geht es aber auch noch um Umwelt, usw. Unter gewissen Vorraussetzungen kann man solche Probleme mit mehreren Zielen dann aber auf eine endliche Abfolge von Problemstellungen des "2-Personen-Nullsummenspiels" zurückführen; in jedem Schritt erhält man ein neues Problem mit einer Zielsetzung weniger, bis man bei endlich vielen Zielsetzungen nach endlich vielen Schritten bei einer "optimalen" Lösung angelangt. Pareto-Optimal (.... zB.: Vektor (1,100) ist halt schlechter als (1,1000); aber es gilt auch (1,100) ist schlechter als (2,100) .  Die Vektoren (2,100) und (1,1000) lassen sich gemäß "Pareto-Prinzip" dann aber schon nicht mehr vergleichen. ....) muß das Eregbnis sowieso sein; es muß auich MAXMIN-Optimal sein, dh Vektor (1,100) ist schlechter als (2,100), na klar; aber (50,50) ist besser als (49,10000), weil da das Minimum der 2 Komponenten (50) nunmal größer ist als das Minimum von (49,10000), was nunmal 49 ist. Unter all diesen Pareto-Optimalen Möglichkeiten und den darunter auch noch zusätzlich "Maxmin-optimalen" Lösungen gibt es dann eben uU auch noch eine LEXMAXMIN-optimale Lösung; ein ähnliches Prinzip, das X-Kriterium, wurde zB bei der Suche nach "sinnvoller Aufgabenverteilungen" von Prof. Behringer gefunden (Es wurde eine möglichst sinnvolle Verteilung der Aufgaben der Professoren der TU München gesucht; Keiner sollte begründeten Anlaß zu Beschwerde haben); jede LEXMAXMIN-optimale Lösung ist dann wiederum X-optimal - aber nicht umgekehrt -. X-optimale Lösungen sind wiederum stets sowohl Pareto-optimal als auch MAXMIN-optimal. Aber die "Spieltheorie" zeigt einem bereits, dass man bei solchen Entscheidungsproblemen sich vernünftiger und weniger vernünftig bis hin zu sehr unvernünftig entscheiden kann und daß man sich halt damit etwas befassen sollte, statt einfach d'rauflos zu entscheiden, d'rauflos zu handeln usw.

Es ist doch irre an so einem Würfelspiel teilzunehmen, alles zu verlieren, weil man auch noch riskierte einem Falschspieler gegenüber gesessen zu haben und hinterher versucht man sich alles per brutalem Krieg zurück zu holen; jener Krieg läßt sich, lt. jenem ca 20-bändigen Fischer's Lexikon Geschichte, Band über Indien, bis auf ca 200 Jahre genau datieren; die Tatsächlichkeit wird als von Historikern nicht bestritten.....

Ebenso irre ist es, zB junge Menschen in so eine "Würfelspielsituation" hineinzutreiben und so zu tun, als müsse das so sein, weil sie sonst nicht bereit wären "zu zuhören", "sich belehren zu lassen" odgl. Man kann doch nicht von "Wissenschaftlichkeit" reden, hat an der MIU, Maharishi International University einen Professor für Mathematik und dann redet man über diese Aspekte wie man Alltag und Erleuchtungstreben sinnvoll unter einen "Hut" bringen kann nicht einmal. Selbst im Zusammenhang mit MathematikstudentInnen tut man so, als würden die "Meditierenden" das eh nicht kapieren können oder auch einfach nicht kapieren wollen - so nen Blödsinn!

Selbst Grundschulkinder können das Beispiel Eis-Regenschirm von Prof. Behringer sehr wohl verstehen und sie verstehen, daß es angesichts von unangemeldeten Ex-en nur eine sichere "Strategie" gibt, nämlich sich auf jede Stunde vorzubereiten; im "ungünstigsten Fall" kommt nämlich ne Ex genau dann, wenn man sich mal nicht vorbereitet hat und dann ärgert man sich hinterher noch; wenn man das dann nachlernt, kann man's zwar, aber wird nicht mehr mit guter Note belohnt und die schlechte Ex-Note bleibt einem auch noch.

Was ist Wenn's Erleuchtgung gar nicht gibt? Was ist wenn's Ereluchtung, Ausweg aus Leid, Tod gegegeben hätte? Man will weder im einen Fall noch im anderen Fall der totale Depp sein; also gilt's eine sinnvolle Strategie zu suchen)



Bei http://www.astrojyoti.com/sivasuktas-3.htm fand ich auch die Shivasutras:

Interessant ist hier wieder:

>>Supreme Consciousness is the turiya (fourth) state of consciousness beyond the three states of waking, dream and deep sleep. This state is eternal and the other three states come and go in it.<<

Auf Deutsch:

Höchstes Bewußtsein ist der Turiya (der vierte) Bewußtseinszustand jenseits der drei Zustände des Wachens, Träumens und des Tiefschlafes. Dieser Zustand ist ewig und die anderen drei Zustände kommen und gehen (von mir übersetzt, Schul-Englisch, über 8 Schuljahre hinweg als eines der Hauptfächer gehabt).

Nunja, die Ausführungen ad "TM" in den 2 Info-Vorträgen vor der Initiation in TM, entsprechen dem auffallend genau, sodaß man in diesem Punkt schon von Seriösität, Klassischheit etc sprechen kann.

Die vielen positiven wissenschaftlichen Untersuchungen ad TM (darunter Diplomarbeiten, die ja nun in der Regel von nicht TM-ausübenden ProfessorInnen zu berwerten waren) bestätigen insofern die "Klassischheit" der "Transzendentalen Meditation" wie sie, lt. Mr. Mahesh von Swami Brahmanda Saraswati gelehrt worden sei. Allerdings ist das dann sinnvoller- und fairerweise ja wohl kaum als "transzendentale Meditation nach Maharishi Mahesh Yogi" dann zu bezeichnen. Andererseits bemühte sich Mr. Mahesh durchaus darauf hin zu weisen, daß es nicht sein Wissen sei, sondern das was Er während jener 13 Jahre bei Swami Brahmanda Saraswati - als Privatperson aber evtl ja durchaus auch als Shankaracharya - so aufgeschnappt, mitbekommen oder ja teils auch gelehrt bekommen habe. Als langjähriger Privatsekretär mußte Er anscheinend auch immer wieder Darstellungen korrekt machen und wurde da wohl auch von Swami Brahmanda Saraswati mehr als 1 Jahr hinweg immer wieder korrigiert, sodaß Er dabei verständlicherweise was über die Lehren, Anschauungen, Gedanken, das Wissen des Swami Brahmanda Saraswati mitbekam, ja sogar gelehrt bekam.

>>




16)a) Sivasutren:


Eine Übersetzung ins Deutsche, allerdings ausgehend von einer anderen Übertragung ins Englische. findet man übrigens (der Link ist vom 18.2.2018) unter:

http://de.universelle-lehre.de/dharmatexte/shivasutra.html


Saambhavopaaya

1. Chaitanyam Aatmaa
The individual spirit which is no other than the innermost self of man is essentially of the nature of Pure Consciousness or the Reality.


Der individuelle Geist, die individuelle seelisch-geistige Kraft, welche letztlich nichts anderes ist als das innerste Selbst eines Menschen, Wesens, ist im Wesentlichen wesensgleich mit der Natur reinen Bewußtseins oder auch - anders gesagt - der Realität.


2. Jnaanam bandhah
Apparent knowledge vitiated by the illusions of mind is the cause of bondage of the Jiva in the physical world.


Anscheinendes Wissen, das beeinträchtigt, verfälscht ist von den Täuschungen, Illusionen, falschen Vorstellungen des Geistes, der geistigen Aktivitäten ist die Ursache der Gebundenheit des Jiva an die physikalische Welt.                                                                                           


3. Yoni-vargah kalaa-sariram.
Maya (as the generating cause of the universe), class, function and vehicle of consciousness (body) determine the nature of mental knowledge (which is the source of bondage).

Maya (als der erzeugende Anlaß, die auslösende Ursache des Universums), soziale Stellung sowie Schulklasse, Obliegenheit sowie Beruf und Träger, Instrument sowie Medium des Bewußtseins (Körper) bestimmen die Natur geistig-seelischen sowie intelektuellen Wissens (welche die Ursache der Gebundenheit ist).



4. Jnaanaadhisthaanam maatrka
The subtle structural basis of all kinds of knowledge which appear in the mind is the specific power present in the sounds corresponding to the letters of the words, or other modes of motion.


Die subtile strukturell-bedingte Grundlage aller Arten von Wissen, die im Geist vorkommen, ist die spezielle Kraft, die in den Tönen der zugeordenten Buchstaben der Worte gegenwärtig ist oder auch anderen Bräuchen, Moden des Antriebs, der Körperhaltung, Hand- oder auch Körperbewegungen, Winks, udgl.




5. Udyamo bhairavah
The tremendous effort and energy required in the manifestation of a universe comes from the Divine Will of Siva, the Universal Consciousness, and appears initially through
akasa as nada or integrated ‘Sound’ from which all forms of vibration and modes of motion in the realm of manifestation are derived.


Die ungeheuere, außerordentliche Anstrengung und Energie, die für die Manifestation eines Universums erforderlich ist bzw in der Manifestheit eines Universums steckt kommt vom göttlichen Willen Shivas, dem universellen Bewußtsein und erscheint ursprünglich (..anfänglich..) mittels Raum als Nada, was soviel heißt wie integrierter (..fest eingebauter, untrennbar damit verbundener..), ausgeglichender 'Ton', aus welchem alle Formen an Schwingungen und Arten der Bewegung im Bereich der Manifestation (..der manifesten Welt..) sich herleiten.



6. Sakti-chakra-samdhaane visvasamhaarah

By contemplation on the Centre through which Divine Power manifests the universe, (physical) consciousness reverts to its original pure state, Pure Consciousness, and the universe as a separate mental phenomenon disappears

Durch Kontemplation über das Zentrum durch welches Göttliche Macht das Universum manifest werden läßt, verwandelt sich das (physikalische) Bewußtsein zurück in seinen ursprünglichen reinen Zustand und das Universum als separates geistiges Phänomen verschwindet.



7. Jaagrat-svapna-susupti-bhede turyaabhoga-(samvit)-sambhavah

Supreme Consciousness is the turiya (fourth) state of consciousness beyond the three states of waking, dream and deep sleep. This state is eternal and the other three states come and go in it. As the turiya state alone exists and as the three preceding states merge into it and disappear, the turiya state transcends itself and becomes the turiyatita. The Self is the turiyatita, beyond the fourth, state of consciousness.

Höchstes Bewußtsein bildet den Turiya-Zustand des Bewußtseins, den vierten Bewußtseinszustand jenseits der drei Zustände des Wachens, Träumens und Tiefschlafes. Dieser Zustand (Turiya) ist ewig und die anderen drei Zustände kommen und gehen. In dem Maße wie der Turiya-Zustand ein tagaustagein-Phänomen wird, aus sich alleine heraus fortbesteht und die Dreiheit der Vorherigen damit und darin verschmelzen, transzendiert, überschreitet der Turiya-Zustand sich selber und wird Turiyatita. Das SELBST ist das Turiyatita, jenseits des vierten Bewußtseinszustandes, (...jenseits des reinen Bewußtseins wahrgenommen in einem selber bei zu Nicht-Tun beruhigten Sinnen...)



8. Jnaanam jaagrat

The waking state of consciousness comprises, in its widest sense, all knowledge derived by the subjective self in direct contact with the objective world on any plane.

Der Wachzustand besteht im weitesten Sinne aus all dem Wissen, welches das subjektive Selbst in direktem Kontakt mit der objektiven Welt - auf welcher Ebene auch immer - erlangt bzw was es daraus hergeleitet hat.


9. Svapno vikalpaah

The dream state of consciousness comprises, in its widest sense, all knowledge present in the mind when the subjective self is engaged in mental activity unrelated to the physical world of waking consciousness.

Der Traumzustand besteht im weitesten Sinne aus all dem Wissen, das im Geist/im Bereich geistiger Aktivitäten gegenwärtig ist, wenn das subjektive Selbst intensiv mit einer geistiger Aktivität befaßt ist, die in keiner Beziehung zur physikalischen Welt des Wachbewußtseins steht.


10. Aviveko maayaa sausuptam

The deep-sleep state of consciousness comprises, in its widest sense, all knowledge within the realm of the mind unrelated to awareness of the One Reality, caused by Maya.

Der Bewußtseinszustand des Tiefschlafes besteht im weitesten Sinne aus all dem Wissen, das im geistigen Bereich ohne Bezug zum Gewahrsein der einen Realität, verursacht von MAYA vorhanden ist.



11. Tritaya-bhoktaa viresah

He in whose consciousness all these three physical states have become fused and been transcended into one integrated state can wield all powers within that limited realm of manifestation.

Jemand, in dessen Bewußtsein alle diese drei physikalischen Zustände eine Sicherung/Festigung erhalten haben und transzendierend in einen integrierten Zustand gelangten, können alle Mächte innerhalb dieses begrenzten Reiches von Manifestiertheit kennenlernen/mit einigen vorteilhafterweise in Beziehung gelangen.



12. Vismayo Yogabhumikaah

The states attained and experiences gained in the different stages of Yogic practice are really astonishing.

Die Zustände, die erreicht werden und die Erfahrungen, welche Ausübungen von Yoga im Rahmen der verschiedenen Etappen mit sich bringen, sind wirklich erstaunlich.


13. Icchaa-saktir umaa kumaari

The divine power working through a Yogi, still confined within the realm of manifestation, though astonishing, is still unwedded to the Divine Consciousness of Siva in the Un-manifest and is, therefore, not truly infinite.

Die göttliche Kraft, die sich mit dem Yogi durch ihn durcharbeitet (...in einem Yogi am Werke ist...) und noch beschränkt ist, behindert wird innerhalb des Bereichs der Manifestation/der manifestierten Welt, ist – obgleich erstaunlich seiend- noch unvereint, als wie nicht verheiratet mit Shiva's Göttlichem Bewußtsein, als wie nicht verheiratet mit dem Göttlichem Bewußtsein wie dessen von Shiva im Unmanifesten und ist, deshalb, nicht wirklich unendlich.



14. Drsyam sariram

The objective world around a Yogi appears as the body of Siva, no different from his own body, owing to transcendence of the three states of physical consciousness.

Die objektive Welt um einen Yogi herum erscheint (dem Yogi), aufgrund der Transzendenz der 3 physikalischen Bewußtseinszustände, wie der Körper Shivas - dh nicht wesensfremd vom Körper Shivas und der Körper Shivas nicht wesenfremd von der objektiven Welt, die den Yogi umgibt -, wie ununterschieden von seinem eigenen Körper- sodaß Ihm, dem/der/zwi Yogi, andere Körper  so schätzens-, bewahrens- und behütenswert erscheinen, wie der eigene Körper - , oder auch anders herum übersetzt: Shiva erscheint einem Yogi, der die 3 pyhsikalischen Bewußtseinszustände als Formen des einen transzendentalen, absoluten Bewußtseins erkannt hat, körperlich nahe als wie die physikalische Welt, die ihn umgibt und andere Körper werden hoch geachtet wie der eigene Körper.



15. Hrdaye chittasanghattaad drsyasvaapadarsanam

The perception, through the inter-section of consciousness and mind, of the objective world produces in the mind of the Yogi a dream-like state, that is, a purely imaginary (unreal) phenomenon.

Die Wahrnehmung der objektive Welt verursacht im Geist eines Yogi - aufgrund der sowohl-als-auch-Beziehung von Bewußtsein und Geist, aufgrund des Schnittpunkts, des gemeinsamen Punktes von Bewußtsein und Geist (dem transzendentalen Bewußtsein) – einen traumartigen Zustand, welcher ein wahrlich idealistisches, im wahrsten Sinne des Wortes ideal-istisches Phänomen ist oder auch anders übersetzt: Aufgrund der Erkenntnis daß Wachen, Träumen und Schlafen letztendlich nichts als Erscheinungsformen des einen absoluten, reinen Bewußtseins, des Turyia sind, nimmt der Yogi die Welt unmittelbar, wahrheitsgemäß als Art Traumwelt wahr, wissend, daß sein Wissen auf der Basis seiner wahrheitsgemäßen Wahrnehmung von anderen Wesen, die jene Erkenntnis (noch) nicht haben, als rein idealistisch, als wie nur gedacht, weltfremd-lich, nur in dessen Vorstellung existierend erscheint bzw erscheinen täte und zumindest mehr oder weniger viel Klarstellung und Erklärung not-wendig macht und auch angeraten sein läßt, sofern der Yogi ein Schweigen darüber nicht vorziehen sollte.



16. Suddha-tattva-samdhaanaad vaa apasu-saktih

By contemplation on the Reality in Its purity is attained the capacity to overcome the power which binds the soul to the unreal world.

Indem man über die Realität in deren Reinheit bzw Ursprünglichkeit eingehend nachdenkt, sich mit ihr unvoreingenommen (mit reinem Objektivsein) befaßt, erlangt man die Fähigkeit, Kompetenz, welche nötig ist, um die Macht, welche die Seele an die – in Wahrheit - unwirkliche Welt bindet, zu überwinden.





19. Sakti-samdhaane sarirotpattih

By contemplation on the Divine Power which is the source of the objective world, the Yogi can see how all bodies are created by this Power and, with this knowledge, can create them.

Indem man sich in aller Sorgfalt, objektiver Fairness mit der Göttlichen Kraft - mit der Kraft Gottes, wenn es GöttInnen/Göttzwi nunmal geben sollte -, welche die Quelle der gegenständlichen Welt ist, befaßt,darüber kontempliert (jene nicht inhaltsfreie Art von Meditation dazu betreibt) kann ein wahrer Yogi, kurzum ein Yogi sehen, erkennen wie alle Körper von dieser göttlichen Kraft erschaffen werden, vermöge dieser göttlichen Kraft entstehen und kann, mittels dieses Wissens, die Existenz solchiger verursachen.   




20. Bhutasamdhaana-bhutaprthaktva-visva-samghattaah

By contemplation on the nature of the five gross elements, the Yogi gains the capacity to analyze and separate them, and thus to find out how the universe and the objects within have been built or put together through their instrumentality.

Indem man sich in aller Sorgfalt, objektiver Fairness mit den fünf groben Elementen befaßt, darüber „kontempliert“ (jene nicht inhaltsfreie Art von Meditation dazu betreibt), erwirbt sich der Yogi die Fähigkeit sie zu analysieren und sorgsam zu unterscheiden, auseinanderzuhalten und kann so herausfinden wie das Universum und die Gegenstände und Gegenständlichkeiten, durch deren Mitwirkung und Zweckdienlichkeit, darin gebaut oder auch zusammengefügt wurden.




21. Suddhavidyodayaacchakresatva-siddhih

On the dawning of the pure integrated knowledge (consciousness) pertaining to the principle underlying all kinds of manifestation, the Yogi acquires mastery over the Great Centre (Source) through which Divine Power descends into manifestation in order to perform its multifarious functions.

Mit dem unaufhaltsam gewordenen Beginnen des reinen integrierten Wissens (Bewußtsein), geziemend betreffend des Prinzips das allen Arten von Manifestationen zugrundeliegt, begleitet, erwirbt der Yogi Herrschaft über das großartigste Zentrum (die großartigste Quelle) mittels wessen die Göttliche Kraft in Manifestationen eingeht, mit Manifestationen in Beziehung steht um ihre verschiedenen ungleichartige Ansprüche in sich vereinigenden, mannigfaltigen Funktionen, Aufgaben, Rollen zu erfüllen, jenen Aufgaben gerecht zu werden.




22. Mahaahradaanusamdhaanaat mantraviryanubhavah

By contemplation on the infinite reservoir of Divine Energy hidden within the Centre (Source) of Divine Consciousness is gained awareness of the integrated power of Sound present in all mantras through which they achieve their respective aims.

Indem man sich in aller Sorgfalt, objektiver Fairness mit dem unendlichen Reservoir, der nie versiegenden Quelle göttlicher Energie, welche im Zentrum, im Ursprung des Göttlichen Bewußtseins verborgen ist, befaßt, darüber „kontempliert“, wird Gewahrheit, Gewahrsein der integrierten Kraft von Ton erreicht, die in allen Mantren gegenwärtig ist, aber auch gegenwärtig ist im Erreichen der jeweils zugeordneten Ziele oder auch anders gesagt, die dafür sorgt, daß die , den Mantren jeweils zugeordneten Ziele, auch erreicht werden.







Saaktopaaya


1. Chittam mantrah

The mind is based on mantra; the basis of mind in its objective and structural aspect is the power inherent in different combinations of Sounds.

Der Geist, die geistigen Aktivitäten sind auf Mantra gegründet; der Geist ist, betreffs seiner objektiven und strukturellen Apskete, gegründet auf der Kraft und Macht, die verschiedenen Tonkombinationen innewohnt.


2. Prayatnah saadhakah

Success in knowing the relation of mind and mantra, and by utilizing this relation to attain Self-realization, can be attained only by persevering and intelligent effort based upon pure knowledge.

Erfolg betreffs des Wissens der Beziehung von Geist sowie geistigen Aktivitäten einerseits und Mantra andererseits, aber betreffs des Anwendens dieser Beziehung zum Erlangen von SELBST-Verwirklichung, Erleuchtung, kann nur durch beharrliche und intelligente Bemühung, basierend auf reinem Wissen, gehabt werden.



3. Vidyaasarira-satta mantra-rahasyam

Pure knowledge and its acquisition are based upon sound vibrations. Therefore, the secret of acquiring Pure Knowledge concerning the inner-most Self is hidden in the science of mantras.

Reines Wissen und dessen Erwerb basieren auf Ton-Vibrationen. Deshalb liegt das Geheimnis zum Erwerb von Reinem Wissen betreffs des innersten SELBST in der der Wissenschaft der Mantras verborgen.



4. Garbhe chittavikaaso visishta-vidyaa-svapnah

The lower kind of knowledge that develops through mind in the realm of Maya or Prakrti is of the nature of a dream, that is, purely imaginary and un-real.

Die gewöhnliche, weniger entwickelte Art von Wissen,welches durch den Geist und geistige Aktivitäten im Bereich von Maya oder auch Prakriti sich entfaltet bzw entwickelt wird, ist von dessen Natur her wie Träume, welche rein imaginär, illusionär, phatansie-ig oder auch alà „wenn dies&jenes so wäre, dann wäre...“; „gemäß der bisherigen Erfahrungen wäre es dann so und so, aber es ist wahr, daß es sein könnte, daß schon Morgen uns neuere Beobachtungen, Erfahrungen zwingen nicht nur alles neu zu überdenken, sondern uns auch ganz andere Schlußfolgerungen abverlangt werden, die uns dann als der Wahrheit näher erscheinen“ und nicht wirklich, nicht grundsätzlich sind.



5. Vidyaasamutthaane svaabhaavike khechari sivaavasthaa

The Supreme Knowledge that arises in the turyatita consciousness, with the adoption of proper means, is not vitiated by the limitations of individuality (physical states of consciousness), and can exist only in the Supreme State of Reality known as Siva.

Die Höchste Art von Wissen, das Höchste Wissen,welches im Turyatita Bewußtseinszustand wahr wird/erwacht, sich dann auf dieser Basis und nur dieser Basis mittels der richtigen - in diesem Bewußtseinszustand und dem damit untrennbar verbundenen Wissen  enthaltenen - Mittel entfalten kann und entfaltet, wird nicht von den Grenzen, Begrenztheiten, Eingeengtheiten der Individualität (den pyhsikalischen Bewußtseinszustäünden) verfälscht, beeinträchtigt und es kann nur im Höchsten Zustand von Wirklichkeit, im Bereich der höchst entfaltensten Seinsweise, der Wirklichkeit, welche auch als Shiva bekannt ist, existieren.



6. Gurur upaayah

The means of obtaining this Supreme Knowledge is one’s Guru (spiritual preceptor) who has already attained Self-realization.

Das Mittel um dieses Höchste Wissen zu erwerben, ist der eigene Guru (geistiger Lehrer), der bereits SELBST-Verwirklichung erlangt, gefunden hat.





7. Maatrka-chakra-sambodhah

The spiritual preceptor, who initiates the disciple, does this by uniting the consciousness of the disciple with his own, and giving him direct knowledge of maatrka-chakra (mantra-yoga) through which the power of ‘Sound’ descends into manifestation.

Der Schulleiter jener geistigen Schule oder auch der geistige Unterweiser, der Interessenten, Lernwillige initiiert, macht dies zum Einen indem er sich dem Bewußtsein des Interessenten,Lernwilligen anschließt, sich damit zusammentut oder auch eine Verbindung mit seinem eigenen Bewußtsein herbeiführt  und zum Anderen dem Interessenten, Lernenwollenden unmittelbares, eindeutiges, persönliches Wissen des Maatra-Chakras (Mantra-Yoga), durch welches die Macht der „Töne“ auf Manifestationen übergeht oder auch in Manifestationen aktiv wird – insofern anscheinend erstmal eingeht - , vermittelt und insofern gibt.



8. Sariram havih

On the practice of the methods imparted by the spiritual preceptor, the body (the vehicle of consciousness) of the disciple is burnt up in the fire of Knowledge of Reality, and ceases to confine itself to physical consciousness.

Infolge der Ausübung der Methoden, welche der Lernenwollende, Interessent von seinem spirituellen Schulleiter, vom Leiter seiner spirituellen Schule oder auch seinem Unterweisenden erhält, wird der Körper (der Träger des Bewußtseins, das Gefäß des Bewußtseins oder  auch das Gefährt des Bewußtseins) des Lernenden, des Interessenten, des nach jenem Wissen Strebenden im Feuer des Wissens der Realität, im Feuer des Wissens um die Wirklichkeit, im "Feuer" des Kennens der Wirklichkeit gleichsam gänzlich "verbrannt", hört auf die alleinseeligmachende Wahrheit, die einzig wahre Realität, alleinig wirkliche Wirklichkeit von einem  selbst zu sein – oder aber auch, evtl ja falls der Betreffende das Zeugs gar nicht lernen wollte, fuchsteufelwild gemacht, so zumindest gemäß der formal möglichen Übersetzung. (Anm. des Übersetzteres: TM-LehrerInnen kennen das Problem, dass manchmal TM-Ausübende einen falschen Start machen, die TM-Technik nicht richtig ausüben und dann erstmal sowas wie nervöser und nervöser werden odgl; für diesen Fall wird den TM-Kursteilnehmenden im Rahmen des Kurses zur Erlernung der TM ein Gang zu einem TM-Lehrer/zu TM-Lehrerin zwecks sog. "Checking" empfohlen. Das erklärt dann auch, wieso ich diese, formal mögliche Übersetzung explizit anmerke. SchülerInnen, denen man versucht Mathematik beizubringen kennen häufig dieses Problem. Besonders krass war mal ein Fall, wo ich einem Schüler mühsam per kreativer Verkomplizierung, Verumständlicher- und damit Transparenter-, Verständlichermachung beigebracht hatte, große Zahlen durch mehrstellige Zahlen zu dividieren, sodaß er, ohne auch nur ansatzweise in Verzweiflung zu geraten,  dann selbst Aufgaben wie 23335791823 : 34971 routinemäßig erfolgreich per Hand, mit für ihn trefflich abschätzbaren, vorhersehbarem Zeitaufwand lösen konnte; er schrieb dann 4 - also "ausreichend" -statt 6. Aber der, sorry, total fiese, dumme Lehrer schrieb Ihm an den Rand dann hin "umständlich!", weil ihm, anscheinend,  "ausreichend" nicht "ausreichend" genug war - na klar hatte er es nett gemeint gehabt und wollte dem Schüler nur etwas "Ballast", "Mühe" abnehmen; aber Er nahm Ihm leider seine "Schwimmflügel", sodaß er unterging -; daraufhin war, wegen dieser absurden Vermengung von Mathematik und komischen Pädagogik-Vorstellungen des Lehrers, jenem Schüler, völlig unnötigerweise, jegliche Tür zur Mathematik leider erstmal verschlossen.)  - und hört auf, sich auf das physikalische Bewußtsein zu beschränken.



9. Jnaanam annam

Realization of the Self is the true oblation to the sacrificial fire of Supreme Reality.

Verwirklichung des SELBST ist das einzig wahre Opfer an das Opfer-"Feuer" der letztendlichen, Höchsten Wirklichkeit.

(Anm. des Übersetzers: 

Man bedenke betreffs des wiederkehrenden Begriffs "Feuer" - wobei man unwillkürlich leider erst mal an Hexenverbrennungen, Inquisition & co denken zu müssen nicht umhinkommt - , daß der Stoffwechsel der Lebewesen etwas mit sehr langsamer Verbrennung der Nahrung via einer wundersamen, sehr komplizierten biochemisch-enzymatisch geregelten, stufenweisen energetischen Umsetzung, die letztlich viel mehr ist als eine Verbrennung und doch aber auch - bei einer, ein Einzelphänomen herausgreifender, Betrachtungsweise -  einen speziellen, Energieverfügbarkeit in Form von Wärme, usw ergebenden, Vorgang gleichsam enthält, umfaßt, beinhaltet, der einer Verbrennung gleicht oder aber zumindest sehr ähnelt.

Offenbar gibt es auch einen Zusammenhang zwischen diesem "Feuer" des "Stoffwerchsels" und dem Phänomen jener besonders tiefen Ruhe im Rahmen korrekter Meditation . Naturwissenschaftler sähen es als "Beweis" an, wenn der Sauerstoffverbrauch gegenüber 30-minütigem nur Dasitzen  bei entsprechenden 30 Minuten "TM-Ausübung" meßbar und statistisch signifikant geringer wäre. Na klar hätte eine U-Boot-Besatzung oä im Katastrophenfall dann ja am Ende uU etliche, eventuell lebensrettende, Stunden mehr Sauerstoff  auch gehabt, sodaß das Ganze zumindest insofern ein praktisch bedeutsames Thema ist. Das könnte auch einer der Gründe gewesen sein, weshalb sich dereinst der KGB dafür - allgemein und für TM im Speziellen - interessierte)

Das Phänomen der Körperwärme eines lebenden Geschöpfes im Gegensatz zur Kälte eines Leichnams läßt sich nunmal nicht leugnen. Ein Künstler baute mal eine Maschine - welche in der Schweiz auch im Rahmen einer Ausstellung gezeigt und vorgeführt wurde -, die Er "Scheißmaschine" nannte, in welche man oben Nahrungsmittel hineinstecken konnte, zwischendrin wurden von der Maschine in ausgeklügeltem Ablauf synthetische Säure, synthetische Enzyme & co eingebracht und am Ende kam etwas heraus, das aussah und roch wie "Scheiße". Nunja, diese Maschine produzierte vermutlich weniger Energie als sie verbrauchte.

Daß "Feuer der Erkenntnis" und ähnliche Begriffe, sich auf Unsterblichkeit, Erleuchtung, Unbegrenztheit & co beziehen hat offenbar damit etwas zu tun, daß man  - im Gegensatz zur verzehrenden, verbrennenden, verletzenden und todbringenden Situation im Zusammenhang mit Feuer - im Falle von Erleuchtung, Unsterblichkeit etc ein "anderes Feuer", ein nicht verzehrendes, nicht todbringendes Feuer - zumindest - als Thema  hat und nicht umhinkommt oder auch nicht umhinkommen könnte, sich diesen Begrifflichkeiten, etc zu stellen.)



10. Vidyaasamhaare taduttha-svapna-darsanam

While transcending the three states of consciousness, one realizes the dream-like nature of the physical world.

Indem man die drei physikalischen Bewußtseinszustände transzendiert, erkennt man die traumartige Natur der physikalischen Welt. 


Aanavopaaya


1. Atma chittam

Mind is nothing but a derivative and differentiated form of Consciousness, and essentially of the same nature as Consciousness.

Geist ist nichts anderes als eine abgeleitete sowie spezialisierte Form von Bewußtsein und ist prinzipiell von der selben Natur wie Bewußtsein, vom Wesen her nichts anderes als absolutes, reines Bewußtsein.


2. Jnanam bandhah

It is mind (mental knowledge) that is vitiated by the illusion of duality, and is the source and instrument of bondage of the spirit in man which is inherently free, and essentially an expression of the Reality.

Es ist der Geist (das geistig-intellektuelle, in Begriffsbildungen strukturierte Wissen), der durch die Illusion von Dualität beeinträchtigt ist, verfälscht,getäuscht wird und der Geist (das geistig-intellektuelle, in Begriffsbildungen strukturierte Wissen) ist der Ursprung und das Instrument der Gebundenheit des eigentlichen Wesens sowie der seelisch-geistigen Kraft in den Wesen,welche der inneren Natur nach frei und gänzlich Ausdruck der Wirklichkeit sind.


3. Kalaadinaam tattvaanaam aviveko maya

The inability to realize that the phenomena in the realm of the mind are due to the differentiation of principles inherent in Consciousness is the essential nature of Maya.

Die Unfähigkeit zu erkennen, daß die Phänomene im Bereich des Geistes sich aus Grundwahrheiten,Charakteristika,Prinzipien herleiten, die im Bewußtsein vorhanden sind, dem Bewußtsein eigen, Phänomene des absoluten, reinen Bewußtseins sind, ist die grundlegende,wesentliche Natur von Maya.



4. Sarire samhaarah kalaanaam

When the vehicles of consciousness (bodies) are burnt up in the Fire of Knowledge, the differentiated functions of the principles of Consciousness that find expression through the said vehicles also disappear simultaneously.

Wenn, sobald die Träger des Bewußtseins (Körper) im „Feuer des Wissens“ gänzlich „verbrannt“ sind, verschwinden gleichzeitig (parallel dazu) auch die hergeleiteten, davon herrührenden Funktionen der Prinzipien, Grundwahrheiten, Charakteristika des Bewußtseins, welche durch die genannnten Träger einen Ausdruck finden.



5. Naadisamhaara-bhutajaya-bhutakaivalya-bhutaprthaktvani

By the withdrawal of consciousness from the pulse of a living being is attained mastery over the Gross Elements, and the capacity to isolate and separate them from one another.

Durch das – per richtiger Meditation - Zurückziehen des Bewußtseins vom Impuls, Schwung, den Tendenzen eines Lebewesens wird Meisterschaft über die grobstofflichen  Grundtatsachen, Grundbestandteile, Äußerlichkeiten ebenso erworben wie die Fähigkeit sie individuell präzise zu erkennen, benennen, herausstellen und sie von einander zu trennen, unterscheiden, auseinanderhalten zu können.




6. Mohaavaranaat siddhih

In the siddhis or accomplishments (other than final Liberation), there is still moha or delusion of mind caused by attachment that prevents complete freedom or Liberation from the world of manifestation.

Im Bereich der übernatürlichen Fähigkeiten oder auch Errungenschaften (,welche verschieden sind von der schlußendlichen, wirklich wahren Befreitheit und nunmal anders als im Fall der wirklich wahren Befreitheit,)  gibt es immer noch moha oder auch Täuschung,Irrglauben,Irreführung,Selbsttäuschung,Einbildung des Geistes und das Analoge im Bereich der der gedanklichen Aktivitäten, welche von Verhaftetsein, Voreingenommensein,Befangensein,Abhängigsein verursacht wird und welche die vollständige,zeitlose,wirklich wahre,ewig wahre Freiheit,Befreitheit,Unbelastetheit, Ungebundenheit von der Welt der Manifestationen verhindert.


7. Mohajayaad anantaabhogaat sahajavidyaa-jayah

Only on overcoming delusion of mind caused by attachment even to the subtlest objects on the highest planes of manifestation, there is attainment of that Knowledge, inherent in Reality, all-embracing and through which anything can be accomplished.

Der Erwerb, das Erlangen jenes Wissens, jene Kenntnis welche in der Wirklichkeit innewohnend als eigen derselben enthalten ist, das allumfassend, vollständig ist und durch welches – im Rahmen der Wahrheit über die Welt, über Gesetz des Karma, usw usf versteht sich - alles erreicht werden kann, ist nur verwirklichbar, realisierbar, bewirkbar, realwerden-laßbar indem man die Täuschung, Illusion des Geistes, welche die Verwickeltheit in, Gebundenheit an bzw Voreingenommenheit für selbst die subtilsten Gegenstände und Angelegenheiten auf den höchsten Ebenen der Schöpfung verursacht, überwindet.


8. Jagrad dvitiya-karah

The waking state of consciousness in an individual is only the secondary level radiated by the effulgence of the Supreme Light of Consciousness of Siva, the primary level radiated being the consciousness of the Logos.

Der Wachzustand des Bewußtseins eines Individuums ist nur die zweite Ebene, welche vom Glanz des Höchsten Lichtes des Bewußtseins von Shiva ausgeht, die erste Ebene die erstrahlt ist das Bewußtsein des Logos. (Anm. Des Übersetzers; In Wikipedia findet man begl des Begriffs „Logos“ Folgendes: >> Der altgriechische Ausdruck logos (maskulin; griechisch λόγος lógos, lateinisch verbum, hebräisch דבר davar) verfügt über einen außerordentlich weiten Bedeutungsspielraum. Er wird unspezifisch im Sinne von Wort und Rede sowie deren Gehalt („Sinn) gebraucht, bezeichnet aber auch das geistige Vermögenund was dieses hervorbringt (z.B. „Vernunft) wie auch ferner ein allgemeineres Prinzip einer Weltvernunft oder eines Gesamtsinns der Wirklichkeit. Darüber hinaus existieren – je nach Kontext– noch spezifischere Verwendungen, beispielsweise als „Definition, Argument, Rechnung“ oder „Lehrsatz“. Auch philosophische und religiöse Prinzipien werden mit dem Ausdruck lógos bezeichnet, beispielsweise in den Fragmenten Heraklits und in Texten stoischer Philosophie sowie jüdisch-hellenistischer und christlicher Herkunft. <<. Ich gehe davon aus, daß derjenige, der die Shivasutren ins Englische übersetzt hat, hier vermutlich einen umfassenderen Begriff ähnlich oder auch synonym zu „transzendentalem Bewußtsein“ - jenem Turyia - umschreibend zu übersetzen versuchte, indem er die alt-griechische Philosophie zu Hilfe zu nehmen versuchte. Evtl. wird aber auch jener Vorgang bezeichnet, welcher die Erfahrung  momentanen Samadhis - kshanika samadhi -, momentaner Zustände von absolutem, transzendentalem Bewußtsein als Vorstufe zu zeitlosem Samadhi -nitya samadhi – für die Individuen ermöglicht.)



9. Nartaka Aatmaa

Every individual who is aware of his spiritual nature being Atman realizes of his being an actor on the world stage; and he is, therefore, not affected or deluded by the particular role he is enacting.

Jedes Individuum das sich dessen gewahr, bewußt ist, daß seine geistige, seelische Natur nichts anderes als Atman ist, verwirklicht damit verbunden, daß er selber eine schauspielende, darstellende Person auf der Weltbühne ist; und daher wird er weder der speziellen gespielten, ihm zugeordenten Rolle oder auch dem Stück das er spielt vereinnahmt, verfällt auch nicht in Arroganz, Eingebildetheit noch täuscht jene Person sich darüber hinweg, daß es nur eine Rolle ist, die da gespielt wird, dh jene Person verfällt darob nicht in Täuschung, Illusion, odgl.



10. Rango antaraatmaa

The manifested world is the stage on which the manifested Jiva play their limited roles.

Die manifestierte Welt ist die Bühne auf welcher manifestierte Jivas ihre beschränkten,begrenzten Rollen spielen.



11. Prekshakaanindriyaani

The sense organs and the organs of action, and their activity, are the objects of perception in the sordid play.

Die Sinnes- und Handlungsorgane sowie deren Aktivitäten, sind die Objekte der Wahrnehmung in bzw im Zusammenhang mit dem unerquicklichen, nicht leidfreiem Schauspiel.



12. Dhivasaat sattvasiddhih

By complete mastery (transcendence) of intellect, it is possible to make consciousness turn inward, and centred in the atman, the individualized centre of Reality.

Durch vollstände, perfekte, vollkommene Meisterschaft über den Intellekt (,insbesondere zunächst mal fähig geworden sich Transzendenz irgendwie vorzustellen,)  ist es möglich das Nach-Innenwenden des Bewußtseins zu erlangen, zu beginnen und in zeitloser Gefestigtheit im Zentrum des Rades an zu kommen, vollkommene Ruhe, vollkommene Gesammeltheit in und durch Atman, dem individualisierten Zentrum der Wirklichkeit, zu erlangen.




13. Siddhah svatantra-bhaavah

On attaining mastery (transcendence) of mind and intellect, the Yogi attains a state of being beyond the confines of embodied consciousness in varying conditions of time and space.

Durch Erlangen der Meisterschaft (mittels Transzendieren und absolutem reinen Bewußtsein; Anm. des Übersetzers: die Verbindung des Individuums mit Objekten der „Außenwelt“ per des Strahls der Aufmerksamkeit steht nach Erlangen der Erkenntnis - wonach dasselbe reine Bewußtsein in einem selber auch in den Objekten ist – senkrecht auf allen Koordinatenachsen, Richtungen der - mindestens - 3-dimensionalen, „manifesten", scheinbar "realen“' Welt und insofern hat man durch jene grundlegend unparteilich-objektive Beziehung zur Außenwelt dann Meisterschaft über Geist und Intellekt erreicht und zwar durch wirkliches, angemessenes Transzendieren und nicht durch datenverarbeitungsmaschinegemäßer stupider, geistloser Anhäufung von Informationen, „Bücher-Wissen“) über Geist und Intellekt, erreicht der Yogi, inmitten der sich verändernden Gegebenheiten von Raum und Zeit, einen Zustand jenseits der Begrenztheiten des verkörperten Bewußtseins.



14. Yathaa tatra tathaanyatra

The yogi behaves the same way everywhere and anywhere he is.

Der Yogi benimmt sich auf dieselbe Art und Weise (Anm. des Übersetzers: vgl. „Strahl der Aufmerksamkeit steht senkrecht auf allen Richtungen des Raums der sog. „realen Welt“ und das in selbstverständlicher, nicht  mühsam intellektuell odgl sich stets einredender Unart und Unweise), wo immer er ist und dabei ist es auch egal um welchen Zeitpunkt es geht.


15. Bijaavadhaanam

The consciousness of the Yogi is centered in the source of the manifested world, the Supreme Brahman.

Das Bewußtseins des Yogis ist fest gegründet in der Quelle, im Ursprung der manifesten Welt, im erhabenen Brahman.



16. Aasanastho sukham hrade nimajjati

Established in the consciousness of the Atman, the Yogi is immersed in the ocean of bliss and knowledge of the source of the manifested world.

Gefestigt, zeitlos und raumlos Halt gefunden haben in der Gewahrheit  des Atman, im Atman-Bewußtsein tauchte der Yogi in den Ozean der Quelle, des Ursprungs der manifesten Welt, einen Ozean aus Glückseligkeit und Wissen ein.


17. Svamaatraa-nirmaanam aapaadayati

Such a Yogi has the power to create or bring about results, according to the measure of his capacity, which, though tremendous, may still be limited.

So ein Yogi hat die Energie, Kompetenz& Macht, Kompetenz&Möglichkeit etwas per eigener Kreativität zu schaffen oder auch Ergebnisse hervorzubringen und zwar entsprechend des Maßes seiner Fähigkeiten, welche, obgleich enorm, noch begrenzt sein können.



18. Vidyaa-vinaase janmavinaasah

The cycle of birth and death comes to an end only on transcendence of the physical illusory knowledge of the mind.

Der Zyklus von Geburt und Tod kommt nur durch Transzendieren und der absoluten, reinen Transzedenz bzgl des physikalischen, illusionären Wissens des Geistes, zu einem Ende.



19. Kavargaadishu maahesvaryaadyaah pasumaatarah

The Yogi should beware of the divine powers of Mahesvara, the differentiated forms of Adi Sakti, inherent, in their elementary form, in the sounds of letters that perform the functions of creation, producing illusions, etc.

Der Yogi sollte sich in Acht nehmen vor – sich all dessen gewahr sein - den göttlichen Mächten von Maheshvara, der von Adi Shakti herrührenden, abgeleiteten Formen, welche enthalten, innewohnen, inhärent sind, in deren elementarer, grundlegender Form, in den Klängen von Buchstaben, welche die Funktionen der Schöpfung steuern & erhalten, Illusionen hervorrufen, usw. (Anm. des Übersetzers:"In Acht nehmen" nicht weil man vor Shiva, Shakti & co Angst zu haben bräuchte, sondern weil es wohl auf diese Weise mit/in der eigenen, persönlichen Entwicklung, dem Wissen, dem Erkennen, Begreifen usw  "weitergeht".)



20. Trishu chaturtham tailavad aasechyam

Supreme Consciousness is the turiya (fourth) state of consciousness beyond the three states of waking, dream and deep sleep. This state is eternal and the other three states come and go in it. As the turiya state alone exists and as the three preceding states merge into it and disappear, the turiya state transcends itself and becomes the turiyatita. The yogi is to strive to be in this state of consciousness without interruption like the flow of oil.

Das erhabene Bewußtsein ist das Turiya, der vierte Bwußtseinszustand jenseits der drei Zustände, jenseits des Wachens, Träumens und Tiefschlafes. Dieser Zustand ist zeitlos, ewig, unabänderlich und die anderen Zustände kommen und gehen; die anderen Zustände entspringen und enden in Ihm. Wenn der Turiya-Zustand nicht mehr „nur“ mit den anderen Drei - dem Wachen. Träumen und Schlafen - co-existiert, sondern zeitlos, unabänderlich, alldurchdringend „existiert“ und die anderen, die vorgenannten, vorherigen Zustände sich als eins damit, als eine Erscheinungsweise von Turiya seiend heraustellen, somit damit verschmelzen, daher und nur insofern verschwinden, transzendiert sich der Turiya-Zustand selber und wird zu Turiyatita. Der Yogi muß sich darum bemühen, darum bestrebt sein, die not-wendige Anzahl von Meditationsausübungen und insofern Anstrengung, Bemühung und Zeit  aufwenden, um in diesen Bewußtseinszustand des Turiyatita dauerhaft, zeitlos sowie allzeit wahr zu gelangen; so wie Öl zähflüssig, nach eigenen Gsetzmäßigkeiten der Viskosität aber auch Trägheit fließt - man Geduld und insofern eine gewisse Hingabe aufzubringen hat -, so ist der Übergang vom Bewußtseinszustand „Turiya“ zum Bewußtseinszustand „Turiyatita“ geprägt von seiner eigenen Natur, seinen eigenen Gesetzen.




21. Magnah svachittena praviset

The yogi enters the turiya (fourth) state of consciousness by way of diving into it from any of the physical states of consciousness.

Der Yogi gelangt in den Turiya (vierten) Zustand des Bewußtseins indem er darin, ausgehend von irgendeinem der physikalischen Bewußtseinszustände – dem Wachen Träumen oder auch Tiefschlaf - gleichsam eintaucht, per „transzendentaler“ Meditation (...und nicht durch eine Meditation, die von Inhalten zu Inhalten zu gehen sich als Gesetz, als das Prinzip derselben gibt..).



22. Praanasamaachaare samadarsanam

The attainment of the fourth (turiya) state of consciousness transcending the three states of physical consciousness requires the regulation of the currents of prana and kundalini in their respective channels within the body.

Das Erlangen, Erreichen, Verwirklichen des vierten (Turiya genannnten) Bewußtseinszustands, welcher jenseits der drei physikalischen Bewußtseinszustände liegt - von den drei anderen Bewußtseinszuständen grundlegend verschieden ist - , erfordert eine Regulierung der Ströme des Prana und der Kundalini in – im Rahmen - deren jeweiliger Kanäle innerhalb des Körpers.



23. Madhye varah prasavah

The attainment of the fourth (turiya) state of consciousness transcending the physical states of consciousness, lower in nature, arises owing to samskaras (impressions) resulting from the karma of the lives in the past.

Das Erlangen des vierten (Turiya) Zustandes des Bewußtsein der jenseits der physikalischen Zustände des Bewußtseins liegt – die von ihrer Natur her „niedriger“,“oberflächlicher“ - da sich mit Veränderlichkeiten befassend, was auch ein „Hätte-verzichtet-gehabt haben-können“, „wäre besser gewesen dies oder auch jenes nicht getan oder auch nicht gedacht gehabt zu haben“ umfassen – , der die drei physikalischen Bewußtseinszustände transzendiert, entfaltet sich auf der Basis von und beeinflußt von Samskaras (Eindrücken), die aus dem Karma der Leben in der Vergangenheit herstammen, die dem Karma der Leben in der Vergangenheit geschuldet sind.



24. Maatraasvapratyayasamdhaane nastasya punar utthaanam.

A state of consciousness is a manifestation of patterned interaction of physical, biological, psychological and social-cultural factors. Consciousness is related to human nature as we normally understand, and also to the nature of Reality. This leads to the postulation of the levels of consciousness, some being in a normal state and a few others in a higher state of consciousness. Human beings in their ordinary waking conscious state can become aware of themselves (ego), of others (interpersonal), about human nature in general (realities of human nature), universe (aesthetic) and about the external world as such (reality). Transcendent awareness is available to those who are able to go beyond the confines of space–time frame work. But when one experiences transcendence, one is open to other realities. This experience will have profound influence on other aspects of awareness. The interrelatedness of different aspects of consciousness leads to the breakdown of compartmentalized outlook for one experiencing transcendent awareness resulting in the awareness of the Self.

Ein Bewußtseinszustand ist eine Manifestation einer gemusterten, strukturierten, wie geordnete Muster aufgebauten Interaktion physikalischer, biologischer, psychologischer und sozial-kultureller Faktoren. Bewußtsein wird, gemäß dem üblichen Verständnis nach, der menschlichen Natur zugerechnet; ein Bewußtseinszustand wird darüber hinaus auch der Natur der Wirklichkeit zugeordnet. (Anm. des Übersetzers: Etwas das sich nicht ändert wird als Gesetzmäßigkeit, Wahrheit bezeichnet; ein Bewußtseinszustand, jenes turiya sowie turiyatita, der seiner Natur nach unveränderlich, ewig, zeitlos ist, ist daher ebenfalls als „Wahrheit“ und dessen Natur sowie Eigenschaften „als Gesetzmäßigkeit“ zu bezeichnen). Dies führt zu einer Postulierung, Feststellung, Anerkennnung von „Ebenen des Bewußtseins, Bewußtseinsebenen (Anm. des Übersetzers: Man könnte ja meinen, daß es in der euklidischen Geometrie genug sei, „Strecken“ genau postuliert und axiomatisch gegeben zu haben. Aber, erstaunlicherweise, läßt sich dem Begriff „Strecke“ dann noch, ohne daß das aus in den anderen Axiomen schon enthalten, daraud herleitbar wäre, auch noch eine Länge zuordnen und die Länge einer Strecke ist unabhängig von der Strecke selber, aber konsistent dazu; die Länge einer Strecke ist eine, 1 reelle Zahl und eine Strecke ist ein Gebilde aus unendlich vielen Punkten und Teil einer Gerade...). Einige entsprechen einer normalen Bewußtseins-Ebene und andere werden einem „höheren Bewußtseinszustand“ zugeordntet. Menschen können im gewöhnlichen Wach-Bewußtseinszustand ihrer selbst (ego), Anderer (mehrere Menschen betreffend), menschlicher Natur im Allgemeinen (Wahrheiten über die menschliche Natur, unterschiedliche Realitäten derselben), des Universums (ästhetisch, den Gesetzen des Schönen entsprechend) und der externen Welt als solcher („Realität“) gewahr, bewußt werden. Transzendentales Bewußtsein, transzendentale Gewahrheit, transzedentales Gewahrsein ist für jene verfügbar, erreichbar, die über die Begrenzungen durch den Rahmen von Raum und Zeit hinauszugelangen in der Lage sind. Aber wenn man der Transzendenz gewahr wird, transzendentales Bewußtsein erlangt, ist man für andere Wirklichkeiten – als der zuvor genannten, also anders als wie ego, Anderer, usw - offen. Diese Erfahrung wird grundlegende, tiefgreifende, bedeutsame Auswirkungen haben auf andere Aspekte des Gewahrseins, auf andere Aspekte des Bewußtseins, auf andere Aspekte der Gewahrheit, auf andere Aspekte der Bewußtheit. Die wechselseitigen Beziehungen, Verbundenheiten, Verflochtenheiten unterschiedlicher Aspekte des Bewußtseins führt für jene, die transzendentale Gewahrheit erlangen und dadurch zur Erfahrung des transzedentalen SELBST gelangen, zu einem Zusammenbruch der bzw zu einer Abkehr von einer Betrachtungsweise, die in Abteilungen, Kasten-Einteilung, „Schubfächern“ udgl denkt&bewertet.



25. Sivatulyo jaayate

In the fourth (turiya) state of consciousness, the consciousness of the Yogi becomes one with the Constant Integrated Awareness of Siva, the Brahman.

Der vierte (Turiya) Bewußtseinszustand, der Bewußtseinszustand der Yogis wird – im Prinzip, dem Wesen nach  (aber anderen Grades) - eins mit dem Zustand des dauerhaften, integrierten Bewußtseins das Shiva auszeichnet und das Shiva lebt, jenem dauerhaften, integrierten Gewahrsein das Shiva auszeichnet und das Shiva lebt, dem Brahman.



26. Sarira-vrttir vratam

Such a Self-realized yogi, although free from the compulsion of reincarnation, may take on human body in the manifest world to help humanity in the process of Self-realization as an act of austerity.

Eine/Ein/Ön in diesem Sinne verwirklichte/~r Yogin/Yogi/Yogiz kann, obwohl frei seiend vom Zwang zur Reinkarnation - nicht mehr dem Gesetz von Geburt-und Wiedergeburt unterworfen seiend -, einen menschlichen Körper in der manifesten Welt annehmen, um der Menschheit beim Thema SELBST-Verwirklichung, als einem Akt wohlverstandener Askese, strenger Nüchternheit, ohne unnötiger Komplikationen-Behaftetheit, ohne unnötiger Kompliziertheiten und Verkomplizierungen ebenso wie ohne gefährliche Versimplifizierungen oder auch Unterlassungen behilflich zu sein.




27. Kathaa japah

In his case, whatever he does or says is in the nature of a rite in the worship or meditation of the Supreme Self.

In diesem Falle geschieht alles was er/sie/zwi tut oder auch sagt im Stile der Natur einer Gepflogenheit der , aus wahrem Wissen darob herrühenden unergründlich tiefen Wertschätzung, Verehrung des Höchsten SELBST, des unveränderlich, ewig wahren SELBST oder aber auch es geschieht im Stile einer Routine, Gepflogenheit, eines Brauchs von Meditation, die dem Höchsten SELBST entspringt und angemessen ist.



28. Daanam atmajnaanam

Such a yogi ever disseminates the knowledge of the Supreme Self in word and deed. He is the true ‘Guru’ to spiritual seekers.

Eine solche Yogin, ein solcher Yogi oder auch ein ön solch Yogiz verbreitet das Wissen über das Höchste SELBST, über die Wahrheit des SELBST mit Worten und Taten. So jemand ist ein wahrer 'Guru', der einzig wirklich richtige 'Guru' für geistig-spirituell suchenden Personen.



29. Yo avipastho jnaahetuscha

He is the instrument for transmission of true knowledge of the Supreme Self to the spiritual seeker. In the process, he protects him from going astray from the path of realization.

Sie/er/zwi ist das Instrument für die Übertragung richtig wahren Wissens über das erhabene SELBST auf geistig-spirituell Suchende. Im Zusammenhang mit diesem Vorgang – zur SELBST-Verwirklichung der betroffenen Personen – bewahrt er sie vor Irrwegen, Abirrungen vom Weg zur SELBST-Verwirklichung ebenso wie vor gefährlichen Abgründen im Zusammenhang mit dem Weg zur SELBST-Verwirklichung.



30. Sva-sakti-prachayo visvam

Such a yogi is capable of creating a manifested system by the power of the Supreme Self that is endowed on him.

Solche Yogins/Yogis/Yogizs haben die Befähigtheit ein manifestes System - mittels der Kraft und Macht des Höchsten SELBST, welche ihnen zur Verfügung und zur Seite steht – zu schaffen.



31. Sthiti-layau

In the same way, he has the capacity to sustain and bring about dissolution of the manifested system.

In diesem Sinne und Maße, auf diese Art und Weise hat sie/er/zwi die Fähigkeit ein vorhandendes manifestes System – uU in Ordnung bringend - zu erhalten oder auch aufzulösen.



32. Tat-pravrttaavapyaniraasah samvetr-bhaavaat

Although such a Self-realized yogi is capable of or engaged in such activities, he is utterly unattached to them on account of his consciousness ever established in the Supreme Reality.

Obwohl so ein Yogi/eine Yogin/ön Yogzwi, der das SELBST verwirklicht, erkannt hat, fähig ist solche Aktivitäten zu entfalten oder auch damit befaßt zu sein oder daran teil zu nehmen oder auch teilhaben kann, ist so ein Yogi/eineYogin/ön Yogzwi darin äußert nicht-verwickelt, nicht darin verhaftet, bleibt davon unberührt, frei aufgrund dessen, daß sein Bewußtsein immer, überall und allezeit in der Höchsten Realität ruht, in der wahren Wirklichkeit gefestigt ist, unveränderlich teilhat an jener Höchsten Realität.




33. Sukhaasukhayor bahir-mananam

There is no experience of duality (pairs of opposites) such as pleasure and pain in the consciousness of such Self-realized Yogi.

Es gibt im Bewußtsein eines/einer/einez solchen Yogis, der das SELBST verwirklicht, erkannt hat keine Erfahrung von Dualität (es gibt keine Erfahrung von Gegensatzpaaren) so wie Spaß und Leid, Vergnüglichkeit und Schmerz.



34. Tad-vimuktas tu kevali

One who is so freed from duality (pairs of opposites) is truly liberated.

Jemand, der solcherart befreit ist von Dualität (befreit ist von den Gegensatzpaaren, nicht mehr verhaftet ist in Gegensätzlichkeiten) ist wahrlich befreit, aus der „Gefangenschaft durch das Gesetz des Karma“ für immer und überall freigelassen, fortan bestens organisiert, wahrlich emanzipiert.



35. Moha-pratisamhatas tu karmaatmaa

One who is free of delusion of mind because of non-attachment to worldly objects is the true doer of acts. Whatever such one does is always God’s work.

Jemand der, aufgrund von Nicht-Verhaftetsein, Nicht-Verwickeltsein, fairer umfassender Unvoreingenommen sowie Objektivität in Bezug auf bzw gegenüber weltlichen Objekten, Erscheinungen, Phänomenen, frei ist von Täuschung des Geistes und der geistigen Aktivitäten (... geistig frei ist von Illusionen, Täuschungenerliegen, Fatamorganas-für-real-halten, absurdem Sich-Einbilden, Getäuschtwerden, Glauben an Patentrezept „Andere Täuschen, Irreführen oder auch andere so führen, daß deren Verderben billigend in Kauf genommen ist, udgl“..), ist die,der,dzi wahre, richtige Handelnde, ist jemand, der in Wahrheit, umfassend gemäß der Ordung der Schöpfung  Handlungen vollbringt.. Was immer so jemand wann und wo immer tut, ist stets eine Handlung die den Göttern, Göttinnen oder auch Göttzwi, die Gott - wenn es jene nunmal geben sollte - nicht zu wider laufen, die Gottes Billigung oder auch Schmunzeln wenn nicht sogar Wohlgefallen haben.



36. Bhatiraskaare sargaantara-karmatvam

The mind sees all things as different from one another and does not relate them to the One Reality. The one that transcends the mind sees all things as different expressions of this One Reality. One who acquires the capacity to see the Oneness in all functions has equal ease in all spheres and the kingdoms of Nature.


Der Geist sieht alle Dinge als wohlunterschieden voneinander und verbindet, vermischt sie nicht zu Einer Wirklichkeit, ernennt sie nicht zur Einen Wirklichkeit. Jemand der den Geist, die geistigen Akitivitäten transzendiert sieht alle Dinge, Phänomene als wohl unterschiedliche Ausdrucksformen der einen Wirklichkeit. Jemand der die Fähigkeit erwirbt, die Einheit aufgrund des Transzendentalen in allen Funktionen zu erkennen, hat es gleichermaßen leicht in allen Bereichen der Welten und den Reichen der Natur.


37. Karanasaktih svato anubhavaat

The capacity to act with ease and in freedom comes to one naturally and without effort, for one is established in the state of consciousness of the Supreme Reality.

Die Fähigkeit harmonisch - Anm. des Übersetzters, vielleicht kann man ja sagen:wie Wasser es selbst bleibend dahin fließt, da Wasser seiend -, ohne Stress und Gestreßtheit, mit Leichtigkeit und in Freiheit, in aller Ungebundenheit sowie Zwanglosigkeit zu handeln, kommt zu so jemand ohne Anstrengungen, ohne extra sich darum bemühen oder gar sich dazu plagen oder gar quälen zu müssen und zwar, weil so jemand gefestigt ist, teilhat an dem Zustand des Bewußtseins der Höchsten Wirklichkeit und zeitlosen Wahrheit, der Erhabenen Wirklichkeit.



38. Tripadaady anupraananam

The three physical states of consciousness lead ultimately to and merge in the fourth (turiya) state of Consciousness vitalizing it for ultimate realization.

Die drei physikalischen Zustände des Bewußtseins führen letztendlich zum vierten (turyia) Zustand des Bewußtseins und „verschmelzen“ damit, erscheinen nicht mehr als wesensverschieden davon sondern, erscheinen, das Bewußtsein für die endgültige Verwirklichung, wahre Erkenntnis belebend, immer mehr als eine Erscheinungsform des absoluten, reinen Bewußtseins, als durch und durch durchdrungen  vom und in wahrer, wirklicher Beziehung stehend zu absoluten, reinen Bewußtsein.



39. Chittasthitivat sarira-karana-baahyesu

As in the case of mind, the body and the organs of sense and action are also on the periphery of Consciousness and do not affect its deeper levels.

So wie auch in Bezug auf den Geist und die geistigen Aktivitäten, sind die Sinnes- und  Handlungsorgane peripher in Bezug auf das absolute, reine Bewußtsein und beeinflussen dessen tiefere Schichten, Ebenen nicht und andererseits sind auch der Geist und die geistigen Aktivitäten peripher in Bezug auf das absolute, reine Bewußtsein  und beeinflußt/beeinflussen dessen tiefere Schichten, Ebenen nicht.


40. Abhilaasaad bahirgatih samvaahyasya

The desire of action in itself limits one to the physical states of consciousness, but does not affect one’s innermost being established in the Supreme Reality.

Die Wünsche, das Verlangen, die Lust nach Handlungen an sich beschränken jemanden auf die physikalischen Bewußtseinszustände, aber sie beeinflussen nicht die Wahrheit über das grundlegend letztendlich innere Teilhaben an, die innere Verbundenheit mit der Höchsten Wirklichkeit, der zeitlosen Wahrheit, der erhabenen Wirklichkeit.


41. Tadaaruudha-pramites tatksayaaj jiva-samksayah

The exhaustion of karma of one leads to the dawning of the awareness of the Supreme Reality and also brings simultaneously an end to one’s existence leading to one’s mergence into the Supreme Reality. One is freed from samsara, the cycle of life and death.

Das Leerwerden, der Abbau, das Überwinden der Ansammlung, des Anhäufens& der Anhäufung von Karma führt zum Erwachen der Gewahrheit der Erhabenen Wirklichkeit und ergibt gleichzeitig ein Ende für die eigene, isolierte Existenz, für die Sterblichkeit der eigenen Existenz, des eigenen Seins indem es zu jener „Verschmelzung“, „Einswerdung“ mit der Höchsten, Erhabenen Wirklichkeit, zur Gewahrwerdung der zugrundliegenden alldurchdringenden Gemeinsamkeit des Daseins und damit der transzendenten Basis für ein unsterbliches Leben in vollkommener Harmonie  bzw zu einer Gewahrwerdung der Alldruchdringentheit jener transzendenten Basis und somit Einswerdung mit jener transzendenten Basis führt. Man ist befreit vom Samasara, befreit vom Kreislauf von Leben und Tod, Geburt und Wiedergeburt.



42. Bhutakanchuki tadaa vimukto bhuyah patisamah parah

When one is freed from the physical and non-physical categories of the manifested world, one’s consciousness reverts to the state of Siva or the Transcendental Reality.

Man ist befreit von den Kategorien der Physisch-, Physikalischheit sowie Nicht-Physisch-, Nicht-Physikalischheit der manifesten Welt, das eigene Bewußtsein kehrt zum Zustand Shivas oder auch der Transzendentalen Wirklichkeit zurück., das Hinweggäuschtsein über die grundsätzliche Einheit mit der Transzendentalen Wirklichkeit - auch der Transzendentalen Wirklichkeit von Shiva und Anderen – hört auf und insofern kehrte das Bewußtsein zum Zustand Shivas oder auch der Transzendentalen Wirklichkeit zurück.



43. Naisargikah praanasambandhah

The principle of vitality, prana, is a physical category of the Jiva related to Prakrti, though it is an instrument connecting a yogi to the Pure Consciousness, in the realm of manifestation. When the consciousness of the yogi merges in the Supreme Reality, the prana remains behind with the body in the physical world, and its association with Pure Consciousness is completely terminated.

Das Prinzip der Vitalität, der Lebensfähigkeit, der Belebtheit, dh Prana, ist eine physiaklische Kategorie von Jiva, die in Beziehung steht zu,verbunden ist mit Prakriti; sie ist gleichwohl ein Instrument, eine Möglichkeit um einen Yogi mit dem absoluten, reinen Bewußtsein in Verbindung zu bringen, einem Yogi zu ermöglichen sich des absoluten, reinen Bewußtsein gewahr zu werden und das obgleich der Yogi in der manifesten Welt zuhause ist. Wenn sich das Bewußtsein des Yogi mit der Erhabenen Wirklichkeit, dem alldurchdringenden transzendentalen Sein vereint, sich dessen gewahr wird und insofern eins wird mit jener transzendentalen Grundlage für vollkommene Harmonie und ewiges Leben, bleibt das Prana mit dem Körper in der physikalischen Welt zurück und dessen Assoziiertheit mit „das ist die Wahrheit über das eigene Leben“, „das ist der Sitz des Bewußtseins“, „da gibt es kein reines Bewußtsein außer dem, das mit diesem Körper verbunden ist, diesem Körper entspringt“ endet vollständig.




44. Naasikaantarmadhya-samyamaat kimatra savyaapasavya-sausumnesu

For those that regulate the forces of prana and kundalini through spiritual practices, their consciousness can move in different planes of manifestation as they will. There is really no confinement of consciousness for them within the realm of manifestation.

Jenen, die ihre Kräfte des Prana und der Kundalini durch korrekte spirituelle Übungen, Praktiken regulieren, harmonisieren, in Ordnung bringen, ist es möglich ihr Bewußtsein zu unterschiedlichen Ebenen der Manifestation zu bringen und zwar nach deren Willen, gemäß deren Wollens. Es gibt für jene keine wirkliche Beschränkung des Bewußtseins – auch nicht innerhalb des Bereichs der Manifestation, den Bereich der Manifestation, den Bereich der Phänomene und Erscheinungen betreffend.


45. Bhuyah syaat pratimilanam

A yogi, who transcends the physical states of consciousness to enter the fourth state of consciousness, can enter, by his will, the physical states of consciousness again, re-enter the fourth (turiya) state of consciousness, and on and on.

Ein Yogi, der die pyhsikalischen Zustände des Bewußtseins überschreitet, transzendiert um in den vierten Zustand des Bewußtseins einzutreten – anders gesagt: im vierten Zustand des Bewußtseins zu vollkommener, unbegrenzter Ruhe und Entspanntheit zu gelangen -, kann aus seinem Willen heraus erneut in die pysikalischen Bewußtseinszustände eintreten, kann abermals, erneut den vierten Zustand (Turyia) des Bewußtseins betreten, herbeiführen,– anders gesagt: im vierten Zustand des Bewußtseins zur Ruhe und Entspanntheit kommen, zum Einssein damit gelangen - usw usf.




- Ende der Shivasutren -



16b) Kali -Karpūrādi-Stotra

                                                                        Hymn to Kālī                      

                                                      Karpūrādi-Stotra


                                                              BY

                                                                ARTHUR AVALON

                                                               (Sir John Woodroffe)

                                              WITH INTRODUCTION AND COMMENTARY

                                                                                  BY 

                                              VIMALĀNANDA-ŚVĀMĪ

                     (Tantrik Texts Series, No. IX)

                       London, Luzac & Co.,

                             [1922]

Scanned  at  sacred-texts.com,  June  2007.   

This text is in the public domain in the United States   because it was published prior to January 1st,1923. These files may be used for any non-commercial purpose, provided this notice of attribution is left intact in all copies.  

Übersetzung des obigen Hinweises in Deutsche (ohne Gewähr): Hymne an Kali Karpuda-Stotra    von Athur Avalon (Sir John Woodroffe) Mit einer Einleitung und einem Kommentar von Swami Vimalananda (Serie der Tantrischen Texte, Nummer IX) London, Luzac & co [ 1922 ] Gescannt von „Sacred-texts.com“ im Juni 2007.

Dieser Text ist Teil der „public domain“ der Vereinigten Staaten von Amerika, weil der Text vor dem 1. Januar 1923 veröffentlicht wurde. Diese Dateien dürfen für jegliche nicht-kommerzielle Zwecke benutzt werden, sofern diese Anmerkung als Hinweis bzgl der Nutzung in allen Kopien in funktionabler, diese Nutzungsbeschränkung korrekt wiedergebend, enthalten ist.   


Hinweis des Übersetzers: Zum Orginal-Text gehört ein ausführlicher Kommentar; aus Gründen von dessen Länge, kann ich jenen – er ist keinesfalls uninteressant - allenfalls erst zu einem sehr viel späteren Zeitpunkt ins Deutsche übersetzen. Die Übersetzung der Verse folgt alsbald noch, so einer nach dem Anderen:

Darstellung einer Maske von Kali in jenem US-public-domain-Text von Sir John Woodroff


Hinweis des Übersetzers ins Deutche: "Anmerkungen des Übersetzers ins Deutsche" sind stets hellblau oder auch dunkelblau unterlegt. Dabei sollten hellblaue Unterlegungen allgemeine Hinwiese sein und die dunkelblau unterlegten Anmerkungen des Übersetzters ins Deutsche sollen speziell Bezüge zu Mr. Mahesh & TM bzw "TM-Scene-(bis ca 1976)-Denkweisen" angeben.


                                HYMN TO KĀLĪ                                      

                   (Karpūrādi-Stotra)                                                                                 


VERSE 1   O  MOTHER  and  Spouse  of  the  Destroyer  of  the  three  cities, they  who  thrice  recite Thy Bīja formed by omitting from Karpūra, the middle and last consonants  and the vowels, but adding Vāmākṣī and  Bindu, the speech of such, whether in  poetry and prose, like that of men who have attained all powers, issues of a surety with all ease from the hollow of their mouth,   Thou who art beauteous with beauty of a dark rain cloud.

Vers 1     Oh Mutter und Gemahlin oder auch Seelenbraut des Überwinders der drei Städte, jenen, die 3-mal dein Bija – gebildet mittels des Übriglassens des mittleren und letzten Konsonanten und der Vokale vom Wort Karpūra sowie jedoch dem Hinzufügen von Vāmākṣī und  Bindu – rezitieren, deren Sprache, ob in Reimen oder auch Prosa, ist solcherart, wie jene Sprache von Menschen, die alle notwendigen Befähigtheiten erlangt haben, in aller Leichtigkeit - aus der Höhle ihres Mundes, mit aller persönlicher Überzeugtheit – und auch aller Zuverlässigkeit die Kern-, die Grundfragen benennen können – denn was anders soll man als unwissendes, unerleuchtetes, sterbliches Wesen sich schon erträumen, erdenken, ersehnen können, Oh Mutter? -. Du, die du außerordentlich, einzigartig, ungewöhnlich schön bist wie die Schönheit einer dunklen Regenwolke.


VERSE 2   O MAHEŚI, even should one of poor mind at any time recite but once another   doubled Bīja of Thine, composed of Īśāna, and Vāmaśravaṇa, and Bindu; then, O Thou who hast great and formidable ear-rings of arrow form, who bearest on  Thy head the crescent moon, such an one becomes all powerful, having conquered even the Lord of Speech and the Wealth-Giver, and charmed countless youthful  women with lotus-like eyes.

Vers 2       Oh MAHEŚI,  sollte jedoch jemand mit beschränktem Verstand, geringerer geistiger Befähigtheit zu irgendeiner Zeit mindestens 1-mal ein anderes doppeltes Bīja von Dir, das aus Īśāna, Vāmaśravaṇa, und Bindu zusammengesetzt ist, rezitieren; dann wird sojemand alle notwendigen Befähigtheiten erlangen, indem Er sogar den Herrn, die Gesetzmäßigkeiten, die Naturgesetztlichkeiten der Sprache und dessen was Wohlstand einbringt „überwindet“, transzendierend hinter sich läßt und zahllose junge Frauen mit Augen schön wie Lotus-Blüten, schön wie Lotus jenem/jenen ihre Ruhe, ihren Frieden, ihre Freude und Freuden ließ, Oh Du, die du großartige und wunderbare Ohrringe in Bogenform hast und die Du erstrahlst in der eigenen, wundersamen unbeschreiblichen, immer wieder einzigartigen kühlen, besänftigenden Schönheit des Lichtes des Vollmondes. - oder welche Vorstellungen sonst sind von einem Menschen mit beschränktem Verstand, sofern es eben solche auch geben sollte, schon zu erwarten als Bedeutung des Wortes Gottes, als Verbindung mit einer Vorstellung eines Gottes, einer Vorstellung von GöttInnen/Göttzwi?

Anmerkungen des Übersetzers ins Deutsche:
- Ja, man nehme von dem Wort den mittleren Buchstaben, von einem anderen Wort den letzten usw, füge das zu einem neuen Gebilde aus Vokalen und Konsonanten, aus Buchstaben zusammen und fertig ist das Mantra; oh je, nunja, Bedeutungsinhalt wird da nur noch sehr schwer, eigentlich ja angesichts der schieren reinen Zufallsauswahl der Buchstaben - praktisch nicht mehr zu finden sein und so werde ich wohl keine Ausrede haben, irgendwelche Gedankeninhalte, die mir – etwa eingedenk der Ausführungen von Swami Shantanand Saraswati zum Thema Meditation - im Rahmen meiner Meditationspraxis, während der Zeiten, die ich für's Meditieren aufwende begegnen nicht irgendwelche Personen, Theorien, Lehren odgl andichten, anhängen odgl können, sondern es könnte wirklich nur mein eigenes – insofern wohl „selbstverschuldetes“ - Verhaftet- Verstricktsein, meine dummen Vorlieben für irgendwelche Worte, lehren, Lautfolgen / co gewesen sein, was mich zu jenen „Ausflügen“ in die Gedanken- und Ideenwelt führte und so sollte es mir wirklich möglich sein, problemlos von solchen Gedanken – ganz gemäß der Ausführungen von Swami Shantanand Saraswati zum Thema Meditation -
wieder zum Mantra und der Fortführung der Meditation zu gelangen, statt mich in irgendwelchen Wahnsinnigkeiten, Scheinzusammenhängen odgl zu verlieren, zu v erirren, zu verstricken, anzufangem solchen  Scheinheiten anzuhängen, anzuhaften usw usf. Ja, das erinnert an besänftigende Kühlheit, eine deiner Eigenschaften, aber na und? So viel Unterscheidungsvermögen werde ich mir schon abzuverlangen wissen; wenn jemand sich nicht einmal mehr das abverlangen kann, wie sollte sojemand dann überhaupt jemals was mit „solcher“ „Meditation“ - also „Meditation im klassisch-yogischen Sinne, mit Meditation, die das Potential hat zu Erleuchtung zu führen, mit „Transzendentaler Meditation“, dh Meditation die einen die eigenen Beschränktheiten, Begrenztheiten, Endlichkeiten überwinden oder auch wenigstens angemessen einzuordnen und durch Wissen über Unbegrenztheit, Unendlichkeit, Zeitlosigkeit (also auch Unverhaftetsein in Dich, Oh Mutter der Zeit und aller Zeitlichkeit)  wirklich zu erweitern und nicht nur bezuglos zu ergänzen vermag, - anfangen können, darüber auch nur ansatzweise vernünftig Bescheid wissen können? Oh Mutter, wenn das Mantra  so „zusammengelöst“ sein sollte, so per reiner Zufallsauswahl entstanden sein sollte, wie sollte es jemand zustehen, dem reinen Zufall „auf die Sprünge“ zu helfen, daß ein bekannter Name eines Gottes, einer Göttin, ön Göttzwi daraus werde? Hat Kirche jemals die Torheit besessen, nachdem die Lottozahlen gefallen waren, dem Zufall nachzuhelfen? Wieso will/wollten amtliche VertreterInnen, ja VerfechterInnen dersölbigen das tun? Wieso wollte ein Bundesgerichtshof Deutschlands das tun, wo der selber Staat eine „Staatliche Lotterie“ betreibt? Oh Mutter und wäre das Mantra aus unergründlicher Weisheit entsprungen, nur dadurch möglich und mir bekannt geworden, wie dürfte ich es abändern wollen, wieso sollte ich daran zweifeln, wieso sollte ich damit nicht aus-und klarkommen können und wollen? Aber wieso benahmen sich Kirchenrepräsentanten und der deutsche Staat als ging es um „Absurdisthan“ - diese Begriffsbildung stammt (ehre wem Ehre gebührt von einer Künstlerin und Lehrerin für Kunst) - und nicht um „Deutschland“? Sie reden als wäre Vernunft dahinter und doch reden sie dümmeres Zeug wie irgendwelche kleinen Kinder, bringen weniger Wissen zum Ausdruck als das „ewige“ Singen eines Waldes im Winde, usw. (...frei nach Johann Wolfgang von Goethe's „Sie nennen es Vernunft und gebrauchen es allein, um tierischer als jedes Tier zu sein“...)



VERSE 3   O KĀLIKĀ, O auspicious Kālikā with dishevelled hair, from the corners of whose mouth two streams of blood trickle, they who recite another doubled Bīja of Thine composed of  Īśa, Vaiśvānara, Vāmanetra, and the lustrous Bindu, destroy all their enemies, and bring under their subjection the three worlds.

Vers 3     Oh KÁLIKÁ, oh Gutes verheißende, viel versprechende Káliká – "Gutes verheißend, viel versprechend" weil die Existenz Gottes, die Existenz von GöttInen, die Existenz von Göttzwi oder auch die Existenz von Gott als wundersames Geistwesen logischerweise nicht als unmöglich begründbar ist und insfern möglicherweise wahr, real, wirklich wirklich ist -  mit wirrem Haar – wirr wie die Verwirrtheit der Unwissenden, Nicht-Erleuchteten -,   Du, aus deren Mundwinkeln zwei Ströme von Blut entspringen,tröpfeln,rinnen oder auch sickern – denn wie soll sich, sterbliches Wesen, Unsterblichkeit schon anders vorstellen können, als ein ewiges, nie endendes Fließen, strömen? Zumindest könnte man es doch so darstellen, nicht wahr? Wie sich anders vorstellen, als immer wieder Ohnmacht gegen Schmerzen und dabei jedoch Heilung erfahren? -  Oh Du, jene die ein anderes doppeltes,verdoppelltes Bíja - zusammengesetzt aus Ísa, Vaisvánara, Vámetra und dem illusteren,erstklassigen Bindu – Deiner rezitieren, überwinden alle ihre Feinde,werden unerreichbar für all deren Feinde und bringen die drei Welten auf ihre Seite, erlangen den Zustand, wo die drei Welten ihnen dienlich sind. - Ist was anderes von Unwissenden, Unerleuchteten zu erwarten als Sehnsucht nach Unerreichbarkeit für all deren Feinde, inklusive all dessen, was sie verletzen, töten, krankmachen, leidenbringen, leidenerhalten, usw usf  könnte, Oh verzeih mir göttliche Mutter, meine Kühnheit, oh Gutes verheißende Káliká? Laß meine Worte bitte doch wie ein die wesentliche Idee irgendwie vermitteltendes Wortgebilde gewesen sein, nimm's verständig, gnädig, denn was anders sollte dein Natur, dein übermenschliches, göttliches Wesen schon sein?  -

Anmerkungen des Übersetzers ins Deutsche:
Bzgl „des doppelten Bijas“ siehe die analogen Ausführungen im Zusammenhang mit Vers 2.

Es kann aber auch, in diesem Zusammenhang und an dieser Stelle bzw Gelegenheit, nicht unerwähnt bleiben, daß es Gurus udgl einfach nicht zusteht - nicht zustehen kann! -, SchülerInnen, Schülzwi in Schwierigkeiten, Petroulien zu bringen oder sie gar - etwa per weltfremder Anweisungen im Zusammenhang mit Kundalini oder auch (versehentlicher oder auch gar absichtlicher) Denunziation per absurdem Nachfragen nach Kundalini-Erfahrungen usw, per rabiatem Initiieren - obgleich die Betroffenen sehr genau wissen/wußten, daß es dafür nicht der richtige Zeitpunkt und auch nicht die passende Gelegenheit  noch ein geeigneter Anlaß sei/war - gar der Verfolgbarkeit oder auch schließlich noch der Verfolgung auszuliefern; ebenso müßte in Zusammenhang mit Organisationen die gebührliche Rücksichtsnahme an den Tag gelegt werden. So mag es ja ok sein, wenn Mr.Mahesh "Lehrzentren" hinterlassen wollte für wahres, gutes Wissen über Meditation, udgl und jene, die sowas etwa per Stiftungen der Welt zu schenken sich bemühen/bemühten mögen da durchaus auch eine gewisse Kontrolle darüber bewahren, was da dann dort auch tatsächlich vor sich geht, um Schlimmstes zu verhüten und so der StifterInnen-Verantwortung gerecht zu werden, aber muß man sich dazu "Königskronen" aufsetzen, sich nach König Rama benennen, Leute ohne Gehalt, ohne soziale Absicherung für jahrzehntelang für sich arbeiten lassen und so Verfolgbarkeit bis hin zu Verfolgung der gesamten "Lehren", "Scene" zu riskieren, zu fördern oder auch zu ermöglichen bzw herauf zu beschwören? Wer Verfolgbarkeit zusammen mit seiner Meditationslehrtätigkeit - zB durch Übertreibungen bei seiner Wortwahl, "Großkotzigkeit", widerlichem bis hin zu kriminellem Umgang mit zB Anhängerinnen, unverantwortlichem Organisationsgehabe/organisatorischem "Gebahren" - heraufbeschwört, hat obigen Vers gewiß nicht kapiert!



VERSE 4   O DESTRUCTRESS of the sins of the three worlds, auspicious Kālikā, who in Thy  upper lotus-like left hand holdest a sword.   and in the lower left hand a severed  head; who with Thy upper right hand maketh the gesture which dispels fear, and  with  Thy  lower  right  hand  that  which  grants  boons;   they,  O  Mother  with  gaping  mouth, who reciting Thy name, meditate in this way upon the greatness of Thy  mantra, possess the eight great powers of the Three-Eyed One in the palm of  their hands.

Vers 4     Oh, Du Überwinderin der Sünden der 2 Welten, Oh Du Befreierin bzgl der Sünden aus den 3 Welten, wundersame Kalika, die Du im oberen Teil der lotusähnlichen linken Hand symbolhaft ein Schwert und im unteren Teil der linken Hand – dem Anschein nach - abgetrennte Köpfe hälst; Du, die in der rechten oberen Hand das Zeichen zeigst, das Ängste zerstreut oder auch zu zerstreuen vermag aber auch deine Furchtlosigkeit zeigt , das von Sorgenbelastetheit befreit oder auch zu befreien vermag und die Du im unteren Teil deiner rechten Hand jenes Zeichen der Gutmütigkeit, des Wohlwollens, der Hilfsbereitschaft, des aktiv, richtig und ordentlich Helfenwollens oder auch Gebenkönnens äußerst; oh großartige Mutter mit geöffnetem oder auch zum Verschlingen bereitem Mund, oh Du großartige Mutter, wer deinen Namen rezitierend und die Großartigkeit, Wunderbarkeit Deines Mantras durch sein Meditieren verehrt, wertschätzen lernt oder sich auch auf die Großartigkeit, Wunderbarkeit Deines Mantras verlassend richtige Meditation pflegt, gewinnt die Vorteile der 8 großartigen Mächte des/der/zwi 3-Äugigen, die für jene so klar, normal, einfach aber auch bedeutsam sowie wichtig und selbstverständlich sind wie ihre eigene Handflächen, die Ganzheit sowie Wunderbarkeit ihrer eigenen Hände.

Anmerkungen des Übersetzers ins Deutsche:
- Oh Du, die das gesamte Know-How bzgl der Sünden, Mängel, bindenden Kräfte der 3 Welten sowie deren Überwindung und Befreiung aus der Verstricktheit in jene hast; Oh Du, an der ich und Andere – aufgrund der Unwissenheit und Verstricktheit in meinen bzw deren Fehler- oder auch mangelhaften Umgang mit der Welt aber auch meinen bzw deren  Mögklichkeiten – immer wieder zweifle, in Bezug auf welche ich und Andere immer wieder ihrer eigenen Täuschung, ihren von Verblendetheit geprägten Vorlieben erliegen und so einerseits Schwert und abgetrennte Köpfe bei und in Dir zu sehen – sich offenbar irrend, offenbar logikwidriger Unweise – sich vermeinen und andererseits sich dahin verirren, zu meinen, daß Du wie eine Sklavin nur darauf warten würdest, ihnen dienen zu dürfen odgl, die aber andererseits auch ganz genau wissen „Wärst Du nicht hinaufgestiegen wärst Du  nicht hinuntergefallen“, „wärst Du bei Schneelage nicht den Berg hinaufgestiegen, hätte Lawinengefahr oder tatsächlich die Qualvollheit  der Erfassung durch eine Lawine für Dich selber niemals bestanden“ udgl, die auch ganz genau wissen, daß sie auch in Harmonie mit der Welt etwas tun können im Allgemeinen und für ihre Gesundheit, ihr Wohlergehen,  Wohlstand in aller Bescheidenheit und Würdevollheit im Besonderen; jene die auch ganz genau wissen, daß es bisweilen möglich war oder auch sein würde, ihnen etwas – ohne Nachteile für Lebewesen und die Welt/Welten – behilflich zu sein, ihnen etwas zu geben, ihnen etwas zu schenken, Oh Mutter die Du - alleine schon von der Logik der Begriffsbildung “Göttin“ her – den Unterschied zwischen dummer,blöder Verschlingerei, sich und anderen schadender Ernährungs- und Lebensweise – richtiger gesagt „Lebens-unweise“ -  einerseits und einer wohltuenden, gesundheitsdienlichen und dennoch selbstverständlich ohne Mord&Totschlag, ohne roden, schlachten/schächten/&co, fischen, tierversuchen, Pflanzen umbringen, usw usf, in Harmonie mit allen Lebewesen, Dir , deinesgleichen, den heiligen, zeitlosen, erleuchteten Welten auskommenden  Ernährungs- & Lebensweise anderseits kennst und das alles zu artikulieren, aber auch lehren sowie dozieren fähig – ja vermutlich oder auch eventuell  sogar bereit-  bist, Du deren Mund so wunderbar offen ist für alles Gute und Bösem – weder in Worten und ganz gewiß auch nicht bei einer Tätigkeit der Nahrungsaufnahme usw- niemals dient, solchem stets verschlossen ist, oh Du großartige Mutter, die Du - aus eigener, reicher Erfahrung - das Wissen über Mantren und richtigen Gebrauch derselben, richtigen Umgang damit, richtiges Weitergeben des Wissens darüber wohl und bestens hast, laß mich dein Schüler, deine Schülerin, die Schülzwi sein, gib mir ein – für mich passendes – Mantra und sei es das, welches Du seit unermeßlichen Zeiten erfolgreich benutzt; Oh Mutter, dann , richtig und mit geeignetem Mantra meditierend, Meditation angemessen ausübend, werde ich Friede finden, dem Verhaftetsein in die 3 Welten entkommen, Befreitheit von den religiösen Kräften und deren Sündhaftigkeitsanklagen auf die eine oder auch andere Weise glücklich und zufrieden  erlangen, werde – von mir aus; auch wenn ich mir derzeit nichts darunter vorzustellen vermag - die 8 großartigen Mächte der Erleuchteten lernen oder auch von Shiva selbst kennenlernen – und evtl ja auch schätzen, ja evtl sogar den richtigten Gebrauch von sowas  mir zu eigen machen können oder auch – auf die eine oder auch andere Weise von Dir und Deinesgleichen – gelehrt bekommen. Oh Mutter verzeih mir, beschütze mich, wenn ich es einfach mit deinem Mantra, dem Mantra versuche, das Du angeblich selber benutzt; was könnte ich anders tun? Ja, man nehme von dem Wort den mittleren Buchstaben, von einem anderen Wort den letzten usw, füge das zu einem neuen Gebilde aus Vokalen und Konsonanten, aus Buchstaben zusammen und fertig ist das Mantra; oh je, nunja, Bedeutungsinhalt wird da nur noch sehr schwer, eigentlich ja angesichts der schieren reinen Zufallsauswahl der Buchstaben - praktisch nicht mehr zu finden sein und so werde ich wohl keine Ausrede haben, irgendwelche Gedankeninhalte, die mir – etwa eingedenk der Ausführungen von Swami Shantanand Saraswati zum Thema Meditation - im Rahmen meiner Meditationspraxis, während der Zeiten, die ich für's Meditieren aufwende begegnen nicht irgendwelche Personen, Theorien, Lehren odgl andichten, anhängen odgl können, sondern es könnte wirklich nur mein eigenes – insofern wohl „selbstverschuldetes“ - Verhaftet- Verstricktsein, meine dummen Vorlieben für irgendwelche Worte, lehren, Lautfolgen / co gewesen sein, was mich zu jenen „Ausflügen“ in die Gedanken- und Ideenwelt führte und so sollte es mir wirklich möglich sein, problemlos von solchen Gedanken – ganz gemäß der Ausführungen von Swami Shantanand Saraswati zum Thema Meditation -
wieder zum Mantra und der Fortführung der Meditation zu gelangen, statt mich in iregndwelchen Wahnsinnigkeiten, Scheinzusammenhängen odgl zu verlieren, zu v erirren, zu verstricken, anzufangem solchen  Scheinheiten anzuhängen, anzuhaften usw usf. Verzeih mir, Oh Mutter, wenn's mir bisweilen so vor kommt, als könnte ich deine Worte von deinen wunderbaren Lippen ablesen, gleichsam deine Gedanken bzgl des Wissens über richtige Meditation erahnen, erraten, verzeih Mir, Oh Wundersame, Allergeschätzeste, Allergeachteteste, wenn ich in der Meditation bisweilen inhaltlich bei Dir bin; aber durch die Wundersamkeit meines Mantras, dessen Zustandkommen-Möglichkeit mittels reiner Zufallsauswahl udgl mir hier kundgetan ist, komme ich stets ohne Gewalt gegen Dich – selbst wenn Du ja mir wirklich real begegnet, ja erschienen sein würdest - immer wieder mühelos, anstrengungslos, ohne irgendwelcher Gefühls- und Intellektmühe-Aufwandbetreibungen, so natürlich als würde mich eine Göttin Parvati, verdeckt, geheim dienstlich so wie geheimdienstlich von mir unbemerkt und unbemerkbar-, umsichtig und beschützend führen - zum wundersamen Mantra zurück, das mich zuverlässig wegführt von Inhaltlichkeiten, Wort- sowie Gedanken-Bedeutungen und hinfinden läßt zum Frieden, zur reinen Harmonie, zu reinem Bewußtsein, zu absolutem Bewußtsein zum  Zustand des „Shivo' ham“, wo die eigene Existenz bar der eigenen Begrenztheiten, Individualismen & co, mal länger mal weniger lang lebendige Realität ist. (...Gerade so wie es - jedenfalls beispielsweise - Shankaracharya Shantanand in seinen Worten über die Meditation zum  Ausdruck brachte und zu bringen vermochte...).

Das symbolhafte Schwert könnte auch für das stehen, was immer wieder zum Tod führt und den Kreislauf von Geburt und Wiedergeburt erhält, nämlich die Unwissenheit. Die abgeschlagenen Köpfe symbolisieren dann eben den Tod, der nunmal Teil des Kreislaufes von Geburt und Wiedergeburt ist. Außerdem symbolisiert es das Leiden - und damit auch das Gesetz des Karma -, das mit jenem Kreislauf immer wieder verbunden ist, solange Lebwesen nunmal nicht Erleuchtung erlangt haben. (Vgl auch die Lehren Buddhas jenbezüglich). Insofern läßt sich dieses "Bild" von Kali sehr gut als Metapher verstehen und begreifen .



VERSE 5   O MOTHER, they who recite Thy charming Bīja, composed of the first of the group of  letters, followed  by  Vahni, Rati, and  beautified  by  Vidhu, thrice,   the  Kürca  Bīja twice, and thereafter, O Smiling Face, the   Lajjā Bīja  twice, followed by the  two Thas, they, O Spouse of the Destroyer of the Deva of Desire  contemplating   Thy true form, become themselves the Deva of Love whose eyes are as beautiful   as the petals of the lotus which Lakṣmī holds in Her playful dance.


Vers 5   Oh Mutter, jene die dein erfreuliches, angenehmes, liebliches Bija - das aus den ersten der Gruppe von Buchstaben, gefolgt von Vahni, Rati und verschönt von Vidhu zusammengefügt ist - dreimal , das Kürca-Bija zweimal und anschließend - oh Du Lächelnde, mit lächelndem Gesichtsausdruck - das Lajjā Bīja zweimal, gefolgt von den zwei „Thas“ rezitieren, jene - oh Gemahlin oder auch Seelengattin des Überwinders des Devas des Verlangens, Begehrens und Forderns  - , die dabei sind deiner wahren, eigentlichen Form sowie Förmlichkeit die gebührliche Beachtung zu schenken, sie kontemplierend zu bedenken, zu beachten, jene erlangen Einigkeit, ein gewisses Einssein, mit dem Deva der Liebe, mit dem Deva der Liebe, dessen Augen so wunderschön sind wie die Blütenblätter des Lotus, welche  Lakṣmī in Ihrem spielerischen Tanz hält.

Anmerkungen des Übersetzers ins Deutsche:
Abermals wird ein Mantra aus Buchstaben gebildet und das in einer Art und Weise, die an zufällige Auswahl, an eine Zufallsauswahl aus einer gewissen Grundmenge erinnert. Diesem Mantra folgen dann gewisse Worte mit Bedeutung nach: Vahni, auch Rati oder auch - mal Verschönerung suchend – Vidhu. Auch andere Mantren kommen ins Spiel, dann geht es in diesem Vers um Rezitieren derselben und also nicht um jenes „jenem Transzendieren dienende Meditieren“ (wie es ja auch Swami Shantanand Saraswati - in seinen Worten bzgl Meditation – beschrieb und insofern ist das eben, aus Sicht der „transzendentalen Meditation“ einfach das was es ist, eine Aussage bzgl „Rezitieren“ gewisser Mantras.

Sucht man nun danach, darin aber auch eine Aussage zu jenem „Transzendieren dienenden Meditieren“ zu erkennen – oder nach reichlicher Meditations-Erfahrung, dh vielen Jahren täglicher (..dh jeweils 2-mal 30 Minuten pro Tag, gemäß  Swami Shantanand Saraswati  bzw  anfänglich „nur“ ca 20 Minuten pro Tag und erst so ab dem 2'ten Jahr dann allenfalls ca 30 Minuten 2-mal täglich gemäß Mr. Mahesh ..) Meditation sich damit mal vergleichsweise befassend, seine eigenen Meditationserfahrungen bedenkend - so sieht es - den Ausführungen von Swami Shantanand Saraswati in seiner Ausführung zu Meditation folgend - so aus, daß „man“, der Geist, die geistigen Aktivitäten in müheloser, anstrengungsloser Weise zur transzendentalen Ruhe gelangen, dann aber auch wieder Gedanken auftauchen – etwa sich auch um Begrifflichkeiten wie Vahni, Rati, Vidhu, irgendwelche Bīja-Mantras  rankend oder aber auch in Form nicht mehr textbezogener bildlicher Vorstellungen, bildlicher Gedanken bzgl Kali und einem „Wie wird/würde sie wohl wirklich aussehen“ Inhaltlichkeit habend - . Jene Meditationausübenden jedoch, die dann stets zum „Eigentlichen“ zurückkehren - sich nicht zufrieden gebend mit irgendwelche Gedanken, bildlichen Vorstellungen (ob sie nun wahr sein sollten oder auch nicht) -, die also die Anweisungen bzgl richtigen Meditierens von Swami Shantanand Saraswati (bzw auch Mr. Mahesh) folgen und sich von den Gedanklichkeiten wieder lösen, darin nicht den Sinn&Zweck des „Transzendentalen Meditierens“ erblicken, sich zuvor darüber im Klaren geworden waren, worum es beim „Transzendieren dienenden Meditieren“ geht und worum nicht, die sich von den Gedanklichkeiten wieder lösen (...und sei es einer/der Wahrnehmung der wahren, allerlieblichsten Form und des freundlichsten Gesichtsausdrucks von Kali selbst..), jene erreichen dann - wieder mal für Momente, wie es Swami Shatnanda Saraswati darlegte -  jene transzendentale Ruhe, welche jenes gewisse Einsein mit reiner Liebe auch ist, jener reinen Liebe, welche selbst jenseits von/der Wellen allergrößen Wertschätzungsempfindungen, ja Verehrung und Berührtheit bei einer Begegnung mit Kali in deren wahren Form und Wirklichkeit, bei einer Begegnung mit Kali höchstpersönlich ist/wäre, jener reinen Liebe woraus Wellen der Liebe, der allergrößten Wertschätzung für Kali bestehen, so wie alle Wellen des Ozeans aus nichts anderem bestehen als wie der Ozean selbst, nämlich Wasser.

Wie sollte die/eine großartige, wunderbare Kali irgendetwas gegen jenes „Transzendieren“ haben können? Sollte sie sich etwa davor fürchten, daß eine Verehrerin, ein Verehrer, ön Verehrzwi Ihrer sich nach jener Erkenntnis sehnt, zu jener Erkenntnis gelangt?

Sollte/könnte etwa eine wahrheitsgemäße Begegnung mit Kali im Rahmen einer Meditationssitzung jener Erkenntnis irgendwie im Wege stehen können? - Gewiß nicht! So eine wahrheitsgemäße Begegnung mit Kali würden allenfalls in diesem Moment zum Erleben dessen führen, was obiger Vers beinhaltet: „Jene, die dabei sind deiner wahren, eigentlichen Form sowie Förmlichkeit die gebührliche Beachtung zu schenken, sie kontemplierend zu bedenken, zu beachten, jene erlangen Einigkeit, ein gewisses Einssein, mit dem Deva der Liebe“. So eine Begegnung würde allenfalls außerordentlich subtile, subtilste gedankliche Aktivität mit sich bringen und insofern eine momentane gedankliche Aktivität des Kontemplierens darstellen, aber diese würde, gemäß den Prinzipien richtigen Meditierens – siehe etwa Swami Shantanand Saraswati und auch Mr. Mahesh - zum Transzendieren zu führen haben, dem Transzendieren gar nicht im Wege stehen, kein Hindernis sein können für's Transzendieren und dem Erlangen eines momentanen Einsseins  mit dem woraus alles Wertschätzen, alles Lieben, alles Verehren, alles Sehnen, alles Hoffen&Bangen, alles Träumen bestehen, jenem Ozean reiner, purer Liebe, Existenz, Wahrheit, Bewußtsein, jenem Sat Chit Anananda, wie es Shankara und andere bezeichneten/bezeichnen/benennen. Siehe auch dazu die Ausführungen von Swami Shantanand Saraswati bzgl „Meditation“.


Könnte dann ein, sich sorgsames, Befassen mit so einem Text wie dem Kali-Karpuradi-Stotra der Erkenntnis widersprechen, im Wege stehen? Nunja lassen Sie es uns bedenken: Wenn man solche Texte fehlinterpretiert, im Alltag weiter Irrsinn veranstaltet und dann den eigenen Irrsinn mit solchen Texten zu rechtfertigen versuchen täte, dann hülfe einem das kaum aus der Patsche. Gewaltätigkeiten, Grausamkeiten, Ekelhaftes, Todesstrafe, Mord&Totschlag, Irrsinnniges wie Tieropfer & co kann man aus diesem Text wahrlich nicht herauslesen und es kann daraus auch nicht folgen; es sind/wären allenfalls vergebliche Versuche eine bereits vorhanden gewesene etwaige eigene Gewaltätiglichkeit, eigene Schlechtigkeit, Niederträchtigkeit & co daraus herzuleiten; aber jene Boshaftigkeiten waren vorher schon da und das mit diesem und ähnlchen Texten rechtfertigen zu versuchen, stellte allenfalls eine Folge jener Boshaftigkeit dar. Nachdem es sich um die Darstellung einer „Göttin“ - oder auch „gedachten Göttin, gemutmaßten Göttin, aber jedenfalls um diese Begrifflichkeit und keine andere – handelt, um die Darstellung eines allmächtigen Wesens, kann eigentlich kein Mensch auf die Idee kommen, sich mit ihr – falls es sie denn geben sollte - selber anlegen zu wollen (schon gleich gar nicht aufgrund dieser Darstellung wo sie mit Schwert & co und als prinzipiell, selbstverständlich unbesiegbar dargestellt wird) und insofern sind solche Texte auch nicht provokativ. Wer sagen täte, der Text habe ihn/sie/zwi zu dieser oder auch jener Schandtat provoziert, lügt nur; verlogen wie Er/sie/wzi wäre, könnte er/sie/zwi gar nicht anders als jenbezüglich zu lügen. Hätte er/sie/zwi eine Ahnung davon, würde sie/er/zwi logischerweise, begrifflichkeitsimanenterweise frei geworden sein von Gewaltätigkeit, Hass, Niedertracht, Morden, Rauben, Vergewaltigen, Unerleuchtetheit, Ursache von Krankheit (KrankheitsüberträgerIn) und Verirrung-Verursachen (Ursache von Fehlentwicklungen, Verirrungen, Irreführungen) usw.

Na klar, sagte/lehrte Mr. Mahesh (im Rahmen eines TM-Lehrerfortbildungskurses, „ATR-Kurs“, in Arosa/Schweiz, ca 1974), daß man ja auch außer über „Klänge“ (also „Ton“ und den Gehörsinn) auch über „einen Geschmack“ (zB – zuckerfrei, wer Sorge ad Karies hat oder aber auch evtl an Diabetis erkrankt ist - auch ein klein wenig von jener Schokoloade, die zu 100% aus Kakao besteht; nicht billig; kostet pro 80g-Tafel ca 4,99.-€ - „Original beans, Cusco Chuncho 100%, enorm dunkler Kakao, Heiliges Tal, Cusco, Peru“; pro gekaufter Tafel wird dann angeblich 1 Baum im Rahmen eines Aufforstungsproramms gepflanzt bzw geschützt) transzendieren könne; ebenso kann man es auch via „Sehsinn“, also ein Bild. Insofern kann eine Darstellung von „Kali“ selbstverständlich auch in jenem Sinne „transzendentaler Meditation“ (wie ein Mantra, aber eben stattdessen) durchaus gebraucht werden. Auch das würde dann nicht als religiöse Verehrung zu bezeichnen sein, da es dabei dann nicht um religiöse Gefühle und einem Huldigen derselben zu gehen haben könnte. In der Tat könnten sogar „religiöse Gefühle“ letztlich wie ein Mantra benutzt werden, wobei es problematisch wäre, von einem genau definierten, stets gleichermaßen verfügbaren „Gefühl“ überhaupt reden zu können. Eine Reise könnte man eben mit einem bequemeren, aber auch denkbar unbequemen Gefährt antreten; auch ständig kaputt gehende Gefährte, die zwar an und für sich, sehr bequem sen könnten, könnten sich dann aber als Umweg und letztendlich total unbequem gewesen herausstellen. Insofern werden eben im Zusammenhang mit jenem „Meditieren im transzendierenden Sinne“, jener „transzendentalen Meditation“ Mantren benutzt oder auch bevorzugt. Wenn Kirche oder auch andere Gruppierungen das nicht so machen wollen, ist das deren Verantwortung, deren Angelegenheit und evtl auch deren Problem dann. Aber es steht ihnen und deren verlängertem Arm, den C-Parteien keinesfalls zu, zugunsten ihrer Parteilichkeit falsche Gerüchte auszustreuen, falsches Zeugnis abzulegen wider die/ön/den Nächste/~zwi/~n, sich in die lehren einzumischen von welchen sie 0,0 Ahnung haben und die sie nicht einmal auch nur 1-mal verstehen haben wollen. Die Vorstellung von GöttInnn, Göttzwis, die eifersüchtig gegen sich intrigieren, Kriege führen usw ist absurd und widersprüchlich in sich selber. Einem Gott Jahwe könnte es doch völlig egal sein, ob jemand via ein Bild einer gedachten oder auch real existenten Göttin Kali transzendentale Meditation praktiziert oder auch irgendein Mantra, einen Klang ohne Bedeutung (so wie Farbe ohne Objektbezogenheit) im Sinne jener transzendentalen Meditation benutzt. Wovor hätte denn so ein alleiniges – und vermutlich dann unvorstellbar einsames? - Wesen nur so panische Angst, daß er sofort alles zu zerstören, zu behindern hätte, was nicht von Begrifflichkeiten, die im Zusammenhang genau mit und nur Ihm stünden, ausginge? Hätte es Angst vor der angeblich ja eigenen Schöpfung?- „Gott“ könnte so ein Wesen jedenfalls kaum genannt werden. Oje, „transzendieren“ heißt doch Begrifflichkeiten hinter sich lassen; oh jemine, da hätte so jemand ja doch tatsächlich für Momente nicht mehr irgendwelche kirchlichen, christlich-religiösen Vorschriften – aber auch keinerlei „sündhafte Gedanken“ odgl! - mehr im Sinne, Im Geist; da würde doch tatsächlich jemand - wenigstens für Momente – Freiheit, Freisein erleben und dabei nicht einmal verbal-begrifflich belästigt werden von Thesen & co zum Thema „Freiheit“. Ja, solche Momente würden wahrlich einem „oh großartige Mutter“, „oh Du Lächelende“, einem „Einsein mit Liebe“ gerecht werden, gerecht sein.  




VERSE 6   O DEVĪ of full breasts, whose throat is adorned with a garland of heads, They who meditating recite any one or two or three of Thy very secret and excelling  Bījas  or all thereof  together with Thy name, in the moonlike face of all such the Devī of Speech ever Wanders, and in their lotus-like eyes Kamalā ever plays.  

Vers 6: Oh Devi voller Brüste, deren Kehle mit einer Girlande aus Köpfen geschückt wird, für jene, die zum Meditieren irgendeines deiner zwei oder auch drei Deiner zu tiefst geheimen super Bijas oder aber auch alljene zusammen mit Deinem Namen rezitieren, gilt, daß im mondgleichen Angesicht all solcher die Devi der Sprache stets entspannt, ruhig, beruhigend wandernd, sich auch windend, schlängelnd und bisweilen sich entfernend oder aber auch bisweilen in - vielleicht ja auch nur scheinbarer -  Unverständlichkeit, Unbegreifbarkeit sich entziehend  anwesend ist und daß in deren lotus-gleichen Augen Kamala stets sein Spiel spielt.


 

 

VERSE 7   O MOTHER, even a dullard becomes a poet who meditates upon Thee raimented with space, three-eyed Creatrix of the three worlds, whose waist is beautiful  with a girdle made of numbers of dead men's arms, and who on the breast of a corpse, as Thy couch in the cremation-ground, enjoyest Mahākāla.

Vers 7: Oh Mutter, selbst ein Einfaltspinsel wird ein Poet, der sich mit Dir, auch meditierend, als gekleidet in Raum, drei-äugige Schöpferin, Quelle der drei Welten befaßt; mit Dir deren überaus schöne Hüfte auch stets sie selber bleibt, vollendet schön bleibt, kühlen Kopf bewahrend und Auswege findend auch angesichts des Gürtels der Vielzahl von Armen von Toten und selbst auf der Brust einer Leiche stehend, daseiend wie sozusagen ein Coach im Einäscherungsboden, sich dabei an Mahakala erfreut.


VERSE 8   THOSE who truly meditate on Thee, the Spouse of Hara, who art seated in  the  cremation-ground  strewn   with  funeral  pyres,  corpses,  skulls,  and  bones,  and   haunted by female jackals howling fearfully; who art very youthful, and art in full  enjoyment upon Thy Spouse, are revered by all and in all places.

Vers 8: Jene, oh Gemahlin oder auch Seelenbraut von Hara, die sich wahrhaft, die Wahrheit anstrebend, objektiv-unparteiisch-unvoreingenommen wahrheitsorientiert, ehrlich mit Dir, dabei/dazu auch richtige Meditation praktizierend, befassen werden hochachtungsvoll behandelt, beachtet werden; es bleibt dabei zu beachten, daß Du auf Beerdigunggrund sitzend voll und ganz Du selber bleibst, niemals deine Lebensfreude, dein Auswegfindenkönnen, deinen Überblick, deine Freiheit, Unabhängigkeit, Handlungshoheit verlierst und das auch nicht bei - gleichsam sitzender- Anwesenheit auf Beerdigungsgrund, beräuchert und ver-~/bedeckt von Scheiterhaufen, Körpern, Hirnschalen,Totenköpfen, Dummköpfen, allerlei Arten von Schlacken und Knochen, auch nicht wenn gleichsam zu jagen versucht von weiblichen, furchterregend und schrecklich heulenden Schakalen, Handlangern und Helfershelfern; Du bist sehr jugendlich, behälst deine ganze Freude an deinem Gemahlen oder auch Seelengatten.

Anmerkungen des Übersetzers ins Deutsche:

Zum Begriff "Seelenbraut" (...oder auch "Seelengattin"...) sei darauf hingewiesen, daß im Christentum eine (zumindest römisch-katholische) Nonne auch als "Braut Christi"  bezeichnet wird und insofern als "Seelenbraut", "Seelengattin". So wie physikalische Phänomene als raum-zeitliche Phänomen verstanden werden und dabei Zeit überall im Raum gleichsam anwesend und dennoch von allem Räumlichen grundsätzlich verschieden, unabhängig ist, stetst Zeit bliebend und nicht zu Raum werdend, so wie dritte Dimension überall auch die Ebene erreicht und mit der Ebene verbunden ist, aber ein Phänomen ist, das von Ebene unabhängig ist und nur jeneseits von "Ebenen-heit", "2-Dimensionalität" wirklich verstanden werden kann, so wird hier Kali als völlig unabhängig, völlig frei bleibend und dennoch als umgeben von und anwesend bei Leichen, Totenschädeln, Begräbnisfeiern usw, stets jugendlich, integer, eigenständig, sie selber bleibend und insofern "völlig erhaben" dargestellt.

Kali gilt ja auch als "Göttin der Zeit" bzw es wird versucht, sich Kali so vorzustellen. Einstein hat in seiner speziellen Relativitätstheorie nunmal dargelegt - und es wird derzeit allgemein akzeptiert, ist auch mathemnatisch nicht allzuschwer nachzuvollziehen/darzustellen (...es konnte im G9-Gymnasium anno 1970/1971 "vorgerechnet", die Herleitung unterrichtet werden...) - , daß man es sich mit der Zeit nicht so einfach machen darf:

 

 

 

 

Nunja, bei aller bildlicher Analogie; Einstein bereute seinen Einsatz für die Atomwaffe hinterher sehr; Kali, als Göttin - und sei es "theoretisch" "nur" mal als das angenommen/vorgestellt" - , macht eben keine Fehler und hat daher nichts zu bereuen. Dennoch scheint mir Einstein zum Thema Zeit, Bedeutendes beigetragen zu haben; das zeigt aber auch, daß man sich auch als "Diener Gottes" (oä) nicht auf seine Lorbeeren ausruhen darf, sollte....



Gewisse Teilchen, die die Erdoberfläche niemals in jener Vielzahl erreichen könnten, kommen dennoch häufiger als es "eigentlich" sein dürfte an, weil sie sich mit nahzezu Lichtgeschwindigkeit bewegen und gemäß der spziellen Relativitätstheorie von Albert Einstein (oder auch Ehepaar Einstein) deren "Eigenzeit" langsamer verläuft, sodaß sie in der "Erdenzeit" eben viel weitere Entfernungen zurücklegen, als es deren zu erwartender Lebensdauer entspräche:

oder noch etwas menschbezogener - und philosophisch im Stil rein "theoretischer Physik" - das "Zwillingsparadoxon":

 

 

 

 


Insofern läßt sich auch das, bisweilen als Nerverei empfundene, "Geschreibe", "Gerede" betreffs "Huld-Gewähren" durch Kali usw - wenn man dies oder auch jenes täte/tut -  begreifen und nicht mehr so primitiv "mittelalterlich" als "Humbug", "wo gibt's denn sowas?" odgl herrabwürdigend, arrogant, voreingenommen, eitel abtun. Wenn man richtig meditiert und jenseits von Raum und Zeit in einem Zustand absoluten, reinen Bewußtseins, Turyia, "angelangt" (siehe auch meine Übersetzung "Swami Shantanand Saraswati spricht"), also auch Zeit "transzendiert", "hinter sich gelassen" hat, treten eben unerwartete, nicht mehr simplen, reduzierten Denkschematas eingebildeter, arroganter, unwissender, oberflächlicher, "mittelalterlicher" PsychiaterInnen, "PhilosophInnen", "JournalistInnen" & co auf.

Man könnte noch weiter bedenken, daß gemäß der Gleichung zur Berechnung der Eigenzeit (eines bewegten "Etwas") (siehe Gleichung 13.10 auf Seite 630 im "Gerthesen-Buch"), Licht, das sich nun,mal mit Lichtgeschwindigkeit bewegt die Eigenzeit 0 hat, dh keiner Alterung mehr unterworfen wäre/ist und sinofern die Qualität von "Unsterblichkeit " hätte. Desweiteren gibt's da ja noch das Phänomen der Längenkontradktion (s. 634/635 im "Gerthsen-Buch"), sodaß "Göttin Kali", als "Lichtgestalt" mal vorgestellt/angenommen, dem "Beobachter auf Erden- also unsereins vor dem Bildschirm, wenn sie einem sozusagen gerade aus dem Bildschirm heraus mit Lichtgeschwindkeit entgegen käme - flach wie eine "gut&sauber aufgespannte Leinwand für ein Kunst-Gemälde" erscheine, vorkäme, dh also ganz&gar nicht mit "vollen Brüsten" & co. Insofern ist es dann wiederum sehr verständlich, daß solche "Attribute"wie "volle Brüste" - im vorliegenden Stotra - extra erwähnt werden. Solche "Attribut-Angaben" würden insofern als Vorbeugungsmaßnahme gehen "Täuschungseffekte aller Arten" anzuerkennen sein und man wäre mit Shankara, Gaudapada, Vasishta und anderern wieder geneigt zu sagen "man hüte sich davor Seil und Schlange miteinander zu verwechseln". Wer im goldenen Amrreifen nur noch eine Form erblickt, die jener Person evtl mißfiele, das Material "Gold" völlig außer Acht läßt oder auch einfach nicht wahrhaben will und den Armreifen wegwerfen täte, würde als ziemlich blöd bezeichnet werden. Nachdem heutzutage wegen des Materials "Gold" weltweit brutal, bestalisch, rücksichtlos, absurd Natur zerstört wird, Lebensräume vernichtet oder auch vergiftet werden, könnte man als Vergleich auch eine Frucht benutzen, die eine vom Hungertod ernsthaft bedrohte Person zu essen sich weigert, weil Ihm die Form missfällt. (Im selben Sinne vermied ich es bei der "flachen Göttin Kali," den "Standardvergleich" "flach wie ein Brett" zu benutzen; da rodet man, um solche Bretter zu produzieren und damit ließ sich sowas wie ein Lebewesen "Göttin Kali" wahrlich nicht vergleichen; es wäre allenfalls üble Beleidigung. Diesen Ausflug in die Physik sollte man nicht überstrapazieren. Es soll zeigen, daß man es sich in manchen Wissensgebieten nicht sehr leicht macht und es der Menschheit insgesamt auch nicht arg schwer fällt jene seltsamen oder auch nur seltsam anmutenden Phänomene und Effekte, welche sich daraus ergeben, zu tolerierien oder auch zu akzeptieren. In Sachen Gott, Göttin, Göttzwi, Kundalini, Yoga, Erleuchtung, Erkenntnis  & co haben es die Reihen der "Fachleute", "der WissenschaftlerInnen", der AkadameikerInnen" leider aber bis heute noch nicht fertig gebracht mit Phänomemen, die ihnen "normal unvorstellbar", "unverständlich", "unfaßbar" erscheinen anständig , seriös und würdevoll umzugehen. Da packen sie dann lieber "der/die/dös ist doch irre", "gehört in die Psychiatrie", "spritzt Ihm die Flausen aus dem Kopf", "den können wir doch noch mitarbeiten und schon gleich gar nicht in leitende Position kommen lassen" aus.(Heutiges Datum: 23.10.2018 ).

Man sollte sich davor hüten, in diesen Dingen hereingelegt zu werden; auch falsche wissenschaftliche Vergleiche, Parallel-Anscheinendheiten udgl stellen so eine Gefahr dar. Wenn doch die Lichtgeschwindgkeit in Diamant nur noch ungefähr die Hälfte von jener des Vakuums beträgt, hätte man da dann mehr Zeit, mehr Chance "Gott" zu sehen? Sowas darf doch kein Grund sein, sich teure Diamanten zu kaufen und nebenbei stillschweigend Umweltzerstörung billigend in Kauf zu nehmen und letztlich finanziert zu haben!

Im Yogavasishta heißt es an einer Stelle, Shiva sei ein aus sich selbst heraus leuchtendes Licht, genauer zB auf Seite 124 unter "Siva unterweist Vasishta":

Shiva sprach:   >> Nicht der Lotusäugige [eine Erscheinungsform Visnus] ist Gott und nicht der Dreiäugige [eine Erscheinungsform Sivas] ist Gott. Wer mit einem Körper auftritt, ist nicht Gott, und wer mit der Natur eines Gemüts versehen ist, ist nicht Gott. Gott [deva] nennt man ein natürliches [genauer: nicht künstlich erzeugtes] Leuchten [devana] ohne Anfang und Ende. Die Verehrung einer Gestalt wurde für diejenigen geschaffen, die das wahre Wesen Sivas noch nicht erkannt haben; wem die Länge einer Yojana noch zuviel ist, für den wird die Länge eines Korsa [ein Viertel davon] festgelegt. Wenn mit den Blumen der Ruhe und des Erkennens usw. im Gott das Selbst verehrt wird, so ist das, sollst du wissen, die eigentliche Gottverehrung. Das Verehren einer Gestalt ist keine Verehrung.

Mit dem Wort Gott [deva] nennt man ein Bewußtsein, welches alle Teile übersteigt, welches aus dem allem Existentsein Gemeinsamen besteht, welches zum Selbst des großen [allumfassenden] Existentseins geworden ist << .....

Auf Seite 26 im selben Buch ("Yogavasishta, Ansata-Verlag, Interlaken, Schweiz, 1988, ISBN 3-7157-0112-9) heißt es zB.:

"Vom höchsten Brahman, das als Ursache aller Ursachen übrig bleibt, wenn es zum großen Untergang kommt, davon wird im folgenden gesprochen. Höre!

Es ist nichts als objektloses absolutes Bewußtsein, unendlich, alterlos, glückselig, makellos und, weil es kein Anfang hat, ohne Anfang, Mitte und Ende. Mithilfe seines Aufmerkens erkennst Du genau das, o Guter, was unter Wahrnehmendem, Wahrnehmen und Wahrnehmbarem das Wahrnehmen ist. 

Ein Wahrnehmen ohne Anfang und Ende, daß Wahrnehmen Licht ist und Wahrnehmbares Finsternis, das ist das Wesen des höchsten Selbst. Worin das Sein [Zusammenspiel] von Wahrnehmbarem, Wahrnehmen und Wahrnehmendem, der Körper hier mit diesen drei Naturen, entsteht und untergeht, das unwandelbare, lautere Seiende, das stets offenbar ist [nie vergeht], das ist das Wesen des höchsten Selbst."


VERSE 9   WHAT, indeed, O Mother, can we of so dull a mind say of Thee whose True Being not even Dhātā, Īśa, or Hari know? Yet, despite our dullness and ignorance, our devotion towards Thee makes us talk of Thee. Therefore, O Dark Devī, forgive  this our folly. Anger towards ignorant creatures such as we, is not befitting Thee.  

Vers 9: Was oh Mutter können wir mit so einem beschränkten Geist schon wirklich über Dich, dessen Wesen nicht einmal  Dhātā, Īśa, or Hari wissen, sagen? Es ist jedoch so, daß wir trotz unserer Beschränktheiten und Unwissenheit aufgrund unserer Sehnsucht nach Dir, unserer Hingabe, unserer Hingegebenheit zu Dir, unserer ahnungsartigen Idee von Dir, uns veranlaßt sehen, über Dich zu sprechen. Deshalb oh Dunkle Devi vergibt uns bitte Jenes, jene unsere Torheit. Ärger in Bezug auf so unwissende Kreaturen wie unsereins würde ja doch gar nicht zu Dir passen, wäre von der Annahme her ja geradezu widersinnig wie es unsereeins scheint, es widerspräche sozusagen unserer "Definition" von Dir.

Anmerkungen des Übersetzers ins Deutsche:
Wenn man einem Menschen heutzutage 1€ schenkt und ihn frägt, was er für sinnvoll hielte, wenn er eine gewisse unbestimmte Anazahl von Euros hätte, so kommt als die üblicherweise für klug gehaltene Antwort, daß es doch am Besten sei/sein müsse/wäre, das Geld so anzulegen, aufdaß mindestens 1.-€ mehr daraus werde. Ähnlich verhält es sich mit Menschen die sexbegeistert sind, die zu erwartende Anwort wäre: "Na klar doch, noch ein weiteres sexuelles Abenteuer, das wär's". Was würden Bergfreaks sagen? Irgendwas wie Folgendes:"Ohjemine ist das aber schwer zu beantworten; na was denkst Du denn? Na klar auf noch einen anderen Berg steigen und wenn's keinen anderen mehr gäbe dann eben auf irgendeinen nochmals raufsteigen, ist doch klar." Stellt man die Frage WissenschaftlerInnen oder auch MathematikerInnen, so wäre die Antwort: "Na klar, dies&das gälte es da auch noch zu erforschen und das sollte endlich mal angepackt werden". Was aber besagt das Gesetz der vollständigen Induktion, jenes "Grundgesetz" der natürlichen Zahlen (Peano Axiom Nr. 5) dazu? All solche Menschen fantasieren von unendlich viel; sei es unendlich viel Geld, unendlich viel sexuelle Erlebnisse, unendlich viel schöne Naturerlebnisse und insofern nie endende, ewige Natur oder seien es auch unendlich viel korrekte, fertige Theorien oder auch Gesetzmäßigkeiten. Was besagt der Verstand dazu nun? Auweia, unendlich viel auf Erden - das geht doch nicht, das würde doch nicht gut gehen; also fantasieren jene eben von irgendwelchen anderen, unendlichen Welten, unsterblichen Wesen - wo man bei der Idee, dem Traum, der "Sehnsucht", der "Fantasie" von "Göttern, Göttinnen, Göttzwis, heiligen Geistwesen - also wie im vorliegenden Text bei jener gewissen, unbestimmten, geahnten Sehnsucht nach Kali - wäre oder aber man kommt auf die Idee von unendlich viel Geburten und Wiedergeburten in einer jeweils endlichen Welt wie der Erde oder aber man kommt zur Idee, zu einer anderen Art von Lebewesen werden zu können, daß dann unsterblich wäre und in einer an-und-für-sich auch beschränkten Welt sodann doch zumindest - aufgrund der Unstebrlichkeit, jenes unendlich lang währenden Lebens - unendlich oft irgendein Mantra würde rezitieren können, unendlich viel poetische Worte würde sprechen können, unendlich oft ein gutes, schönes Lied würde singen können oder auch unendlich viel verschiedene eben, sinnvollerweise es wagen könnte, alle Zahlen 1,2.3 aufzuzählen (Die Jahreszahlen seines Lebens, wären ja die Menge aller natürlicher Zahlen) oder aber auch eine passende Mischung aus all Solchem, also zB einer zwar jeweiles zeitlich endlichen Welt, aber dafür nach jeder "Schöpfungsauflösung" wieder eine neue "Schöpfung" in der alle unsterblichen Wesen wieder ihren Platz haben (siehe Yogavasishta, u.a. Rishi Vasishta hat das große Glück und die unvorstellbare, ehrliche, natürliche, keinesfalls gekünstelte Freude mit der unsterblichen Krähe Busunda zusammen zu kommen und ihre Lebensgeschichte vernehmen zu dürfen.).

Sieht man das nun im Zusammenhang mit dem Thema "Transzendentale Meditation" - wie sie lt. Mr. Mahesh von Swami Brahmada Saraswati gelehrt worden sei - , so  kommt zu jener Aussage, wonach man bei der TM-Technik jene "natürliche Tendenz nach mehr und mehr" "geschickt nutze", "sodaß der Geist ganz natürlich, anstrengungslos und problemlos dort angelange, was unendlich, grenzenlos, ohne Anfang und Ende ist, nämlich absolutem, reinem Bewußtsein jenseits all des Begrenzten und Veränderlichen"(Siehe dazu auch Swami Shantananad Saraswati's Text bzgl Meditation). In jenem Buch "Wissenschaft vom Sein und Kunst des Lebens" (von Mr. Mahesh) wurde sodann der Versuch unternommen darzustellen, wie jener tägliche Kontakt mit jenem Bereich "reinen Bewußtseins", jenes tägliche Erlangen jenes Zustands von reinem Bewußtsein jenseits von Wachen, Träumen und Schlafen auch im Alltag unweigerlich zu positiven Veränderungen führe. Nachdem der Geist, jener Mensch nun jenes gefunden hat, das allein seine Sehnsüchte zu stillen vermag, jenes Unendliche, nie Endende, Transzendente und jenen Weg wissend, wird der Mensch nach jenem "Unendlichen" nicht mehr dort suchen, wo es nicht zu finden ist, nämlich in dem was sich zuvor als Gier nach Geld, Sexgier, Natur-Leidenschaft, absurden wissenschaftlichen Träumen und Fantasien sowie Gier nach Publizieren zeigte und mehr oder weniger, auf die eine oder andere Art und Weise breit gemacht hatte; zumindest würden die Unsinnigkeiten, Radikalismen udgl im Zusammenhang mit den Alltagsaktivitäten, dem endlichen Lebensbereich aufhören. Es würde sich im Laufe der regelmäßigen Ausübung jener Meditationstechnik ein Zustand von Ganzheitlichkeit einstellen, jener Erkenntnis und jenem Bewußtsein von "Brahman", jenem was mehr ist als die Summe aus Veränderlichen, Begrenztem und jenem Unbegrenzten, Unendlichen, Ewigem. Daß da bei mehr oder weniger TM'lerInnen dann das Phänomen auftrat, daß sie mehr und mehr "Mr. Mahesh" haben wollten und "mehr und mehr für TM da sein wolllten" und da irgendwie ja Biersüchtigkeit lediglich gegen Weinsüchtigkeit eintauschten, fiel jenen grosteskerweise dann nicht auf. Warum eigentlich? Eine naheliegende Erklärung wäre, daß sie sehr billige Arbeitskräfte in den Händen derer wurden, die aus "TM" eine "Gelddruckmaschine" machen wollten/möchten und welche selber wiederum auch nur die eine Geldgier nur durch eine Andere ersetzten. Auf jenes Phänomen und weitere wichtige Aspekte dazu gehe ich an anderen Stellen genauer ein. Es ist ganz und gar abzulehnen, wenn Menschen erst versprochen wird, daß man einen Weg in Übereinstimmung mit den Erfordernissen eines Alltagslebens anbietet und dann können jene das plötzlich nicht mehr und man bietet dann auf einmal an kostenlos für Mr. Mahesh zu arbeiten (wobei Er gemäß "David wants to fly"-Zeugenaussage ja dann anscheinend die gewisse Hilflosigkeiten von Mädchen und Fauen dumm, primitiv und abartig für seine eigenen Sexinteressen ausnutzte). Solch ein Gebahren ist seriöser LehrerInnen unwürdig! Wenn man aber erst Physiker anlockt mit "mache TM, kanns'te Dich besser konzentrieren" und hinterher bietet man Ihm "Flugkurse" alà jener "TM-Siddhi-Kurse" an (siehe wiederum jenen Film "David wants to fly" oder aber auch jene denkwürdige ZDF-Sendung mit Thomas Gottschalk wo jene 3 "yogischen Flieger" - übrigens 2 davon kannte ich und es waren defacto nunmal "Profi-TM-Ausüber", die nur noch um Mr. Mahesh herum waren, kein Alltagsleben lebten -  ihre Wette, "Fliegen zu können" tatsächlich gewannen. In der Sendung danach kamen dann jene 2 einer seltsamen "Nachrichtenagentur", deren Absicht oder auch Auftrag es gewesen war, nachzuweisen, daß man in jener Sendung "Wetten Das" durchaus mogeln, betrügen könne und Herr Thomas Gottschalk und seine MitarbeiterInnen bzw das ZDF das nicht merken könnten. Dabei ist/wäre doch das Phänomen "yogisches Fliegen" - das man anscheinend so herum anzweifeln bzw aus der Welt schaffen wollte/in Auftrag mit unbekanntem Auftraggeber aus der Welt schaffen sollte - gar nicht das Problem; das Problem dabei wäre/ist der Missbrauch solcher "Fähigkeiten"/"Lehrfähigkeiten", der absurderweise zu Freiheitsverlust, Rufmord, Karrierezerstörung usw führt/führte.) und macht sich nun auf einmal lustig über die Physik, die langwierige, "umständliche" wissenschaftliche Methode der Physik an sich und deren grundsätzlichen Mangel, wonach man "reines Bewußtsein" ja doch sowieso nie werde messen können und man auch die Phänomene auf der Basis jenes "reinen Bewußtseins" folglich weder physikalisch kapieren noch vorhersagen, ja nicht mal ahnen könne, dann war man einfach nur arglistig, hinterhältig und gemein zu jenen PyhsikerInnen, usw. Man würde das eben von Anfang an dazu gesagt haben müssen und wenn dann zB nen PyhsikerIn sich darauf eingelassen hätte - und sei es mit gewissen "passenden Vorzeichensetzungen" - , so wäre es dann sein Problem, ein Risiko - worauf man ihn/sie/zwi hingewiesen hätte - das er/sie/zwi freiwillig eingegangen war; anderernfalls jedoch wird es für die Betroffenen kaum erträglich und bisweilen auch grundsätzlich unverzeihlich sein, was man ihnen im Namen von "Yoga", "mehr und mehr", "Weltfrieden", "Gesundheit", "volles geistiges Potential", "besserem Sozialverhalten" usw - völlig unnötigerweise, völlig unklugerweise, groteskerweise - antat.

 

VERSE 10   IF by night, Thy devotee unclothed, with dishevelled hair, recites whilst  meditating on Thee, Thy  mantra, when with his Śakti youthful, full-breasted,  and heavy-hipped, such an one makes all powers subject to him, and dwells on the earth ever a seer.

Vers 10: Wenn jemand, der Dir ergeben ist, Dich sucht, bei und mit Dir die Wahrheit sucht, die Nacht nutzend/nutzend wollend wenn Er mit seiner jugendlichen, vollbusigen, wohlgeformte Hüften usw habenden  Sakti unbekleidet mit wirrem, zerzaustem, unordentlichem Haar Dein Mantra rezitiert während Er in Bezug auf Dich, sich auf Dich beziehend meditiert, so jemand unterwirft sich alle Kräfte und weilt auf Erden als Seher. 


VERSE 11   O SPOUSE of Hara, should (a Sādhaka) daily recite Thy mantra for the space of a year meditating the while with knowledge of its meaning upon Thee intent upon Thy union with the great Mahākāla, above whom Thou art, then such a knower has every pleasure that he wills upon the earth, and holds all great powers in the  grasp of his lotus-like hands.  

Vers 11: Oh Gemahlin, Gemahlin oder auch Seelengattin von Hara, sollte (ein Sadhaka) für den Raum eines Jahres täglich dein Mantra rezitieren und die Weile meditieren mit Wissen über dessen Bedeutung im Zusammenhang mit Dir, bedacht seiend auf Deine Einheit mit der großartigen Mahakala, mit der Du grundlegend/wesensgemäß eins bist, dann hat jener Wissende jedes Vergnügen auf Erden, das Er haben will und hält alle großartigen Kräfte, Möglichkeiten, Mächte im Griff seiner lotus-gleichen Hände.

Anmerkungen des Übersetzers ins Deutsche:

"Seelengattin", vgl den Ausdruck "Braut Christi", der für - zumindest katholische - Nonnen gebraucht wird. "Lotus-gleiche Hände" spielt auf "Handeln im Zustand des Nicht-Verhaftetseins " (vgl zB Bhagvad-Gita) an. "Jedes Vergnügen auf Erden das er/sie/dös haben will ist mit "Vorsicht" zu lesen, da nunmal vom Zustand der Erleuchtung ausgegangen wird/auszugehen ist, weil jene Person ja darauf und nur darauf im Zusammenhang mit der Verehrungsübung bedacht war und daher von einer grundlegenden "Geläutertheit" auszugehen ist, vom Rahmen der "Einhaltung der yogischen Lebensideale" wie Gewaltlosigkeit, Nicht-Stehlen, Keuschheit (Nicht-Vergewaltigen, Respekt vor Anderen,...) usw; wenn - es sei mal angenommen, daß ... - jemand Umweltschutz-Engagierte verehren würde, könnte jene Person ja doch auch nicht erwarten, daß sie hinterher sich "umwelt-widrige" "Wünsche" erfüllen zu können dort je würde erlernt haben können. Insofern sind so "Versprechungen" wie "Erfüllung aller Wünsche noch ehe sie aufgekommen sind" (sagte/"lehrte" Mr. Mahesh mal in Bezug auf irgendeinen "höheren Bewußtseinszustand") etwas, was man nicht wörtlich nehmen darf und letztlich "vergessen kann, ehe die Idee aufgekommen ist". Man kann - so die (teils leidvolle)  Erfahrung Etlicher in der TM-Scene - ja nicht mal davon ausgehen, daß man seinen geradlinigen beruflichen Werdegang leben kann. Letzteres mag ja bei "Berufen/Ausbildungen/Studienfächern", die Gewaltaten wie Roden, Schlachten, Tierversuchen, unentsorgbares Sondermüllproduzieren udgl beinhalten durchaus ziemlich "normal" gedanklich nachvollzogen und verständlich, ja auch  - vor Anbieten eines yogischen Lebensweges - erklärt und anerkannt werden können. Aber es kann's nicht sein, wenn jemand dann hinterher plötzlich mit dem Alltag hinten-und-vorn nicht mehr zurecht kommt und das obwohl er bei der Berufswahl eh schon darauf geachtet hatte auf der Seite gut-möglicher Lebensweise zu sein. na klar, es gibt auch "Missbräuche" innerhalb solcher Organisatioen wie den TM-Organisationen damals "SIMS, IMS, WYMS...." usw. Ein "Missbrauch" solcher Organisationen - wie anscheinend ja einst im TM-Umfeld geschehen - zum Zwecke des sich darin Versteckenes, um dann irgendwo im "Ausland" Revolutionen - samt deren Gewaltaten - anzuzetteln oder auch einzelnene unerfahrene (minderjährige zB) TM'ler zu missbrauchen, kann selbstverständlich auch die Ursache von solchen Problemen mit der Gesellschaft, dem Alltag odgl sein.  Wenn aber zB in einem Staat "erweckte Kundalini" als "Geistesgestörtheit" gilt, so ist es nicht gerade fair, wenn man in so einem Staat "Kundalini-Yoga" anbietet. Wer nämlich damit "erfolgreich" wäre, wäre lediglich in ein offenes Messer gelaufen. Na  klar liegt es an jenem Unrechtsstaat, an jener irren Psychiatrie udgl, aber wenn man schon weiß, daß man in einem Staat irgendwas nicht tun darf - zB derzeit am "Platz des Himmlischen Friedens in China rufen "Nieder mit der kommunistischen Partei" - , dann braucht man es a) selber nicht zu tun und b) braucht man keine "hübsch verpackte", "scheinheilig verpackte" Lehre verbreiten, als deren Ergebnis jemand das dann zu tun nicht mehr umhinkäme, was Ihm staatliche Sanktionen, wie Arbeitslager, Gefängnis, Psyschiatrie-Folter & co einbrächte.


VERSE 12   O  MOTHER, Thou givest birth to and protectest the world,  and at the time of dissolution dost withdraw to Thyself the earth and all things;  therefore Thou art  Brahmā, and the Lord of the three worlds,  the Spouse of Śrī, and Maheśa, and all otherbeings and things.  Ah Me! how, then, shall I praise Thy greatness?  

Vers 12: Oh Mutter, Du bringst die Welt hervor und beschützt sie; und wenn die Zeit der Auflösung gekommen ist, ziehst Du Dich selbst, die Erde und alle Dinge zu Dir zurück; deshalb bist Du Brahma und die Herrin über die drei Welten, Die Gemahling von Shri, Mahesa und allen Wesen als auch Dingen. Achja, mich betreffend! Wie dann, werde ich deine Größe angemessen würdigen?


Anmerkungen des Übersetzers ins Deutsche:

Aus der Sichtweise von TM bzw jener TM-Lehre, sind hier 2 Aussagen wesentlich:
i)  "und wenn die Zeit der Auflösung gekommen ist, ziehst Du Dich selbst, die Erde und alle Dinge zu Dir zurück; " heißt es. Wenn man TM ausübt (vgl Swami Shantanand Saraswati zum Thema Meditation, die als Übersetzung in dieser Befassung enthalten sind), zieht man den Geist von den Sinnen zurück, der Geist kann per der TM-Methode zur Ruhe kommen/werden und reines, absolutes Bewußtsein/"Turyia" wird "erfahren"/"stellt sich ein", so wie sich Wachen, Träumen und Schlafen "einstellen" und zwar schon"erfahren" werden, aber das "Erfahren" derselben üblicherweise nicht beachtet/registriert wird, sondern stets oder auch vor allem oder auch bisweilen nur irgendwelche "Inhalte". Reines, absolutes Bewußtsein, Turyia ist seiner Natur nach "zeitlos" und wie dieser Vers besagt ist das so nicht wirklich richtig, denn es hat sich die Zeit lediglich auch "dorthin" zurückgezogen, sich als das "eingestellt". In jenem Sinne wird das dann wohl von jenen, die "Meditation" religiös betreiben bzw aus religiösen Gründen heraus praktizieren, als "Einsein mit der erwählten Gottheit", in diesem Falle Göttin Kali, verstanden, geschätzt und angestrebt. Dieser Vers hat selbstverständlich, vgl Yogavasishta, auch den anderen ganz normalen Sinn, wie Rishi Vasishta dem Prinzen Rama im Zusammenhang mit dem Vergehen der Welt nach einem Äon sowie dessen Wiedererstehen nach jener gewissen "Ruhephase" lehrte (Betreffs jenes Zitats und exakter Quellenangabe sehe man im Absatz über Rishi Vasishta nach). Wenn jemand in dieser Welt, diesem Äon Erleuchtung und Unsterblichkeit erlangt haben sollte, so würde sein "Einsein" mit seiner auserwählten Gottheit - in diesem Falle Kali -  auch dann nicht enden.
ii) "Achja, mich betreffend! Wie dann, werde ich deine Größe angemessen würdigen?". Was passiert, wenn jemand, Transzendentale Meditation praktizierend, transzendiert hatte, in den Bewußtseinszustand "Turyia" ("momentaner Samadhi" ="Kshanika-Samadhi" -> Patanajali-Yogasutren bzw "Turyia" -> Shivasutren) erlangte? Es findet eine weitere subtile Tätigkeit statt, derer so jemand bei regelmäßiger Praxis für jene  ca 30 Minuten morgens und abends (lt. Empfehlung von Swami Shantanand Saraswati) zunehmend bewußt/gewahr wird. Auch im Zustand des "transzendentalen Bewußtseins" findet noch Wahrnehmung statt, zB Geräusche von Außen, Lichteffekt von Außen, usw und die Sinne fangen in jenem Zustand transzendentalen Bewußtseins dann an, sich ebensfalls zurückzuziehen. Eines Tages kommt es dann zur Erkenntnis, daß diese eigenartige Klarheit mit der die Sinne nach jenem "Zurückziehen" ihrerselbst im Zustand des Transzendentalen Bewußtseins  wahrzunehmen begannen daher rührt, daß jenes "Transzendentalen Bewußtsein" eben auch in der Außenwelt, in den Dingen, den anderen Wesen, überall ist. So dämmert also allmählich die Erkenntnis heran "Ich bin das, Du bist das". Reines Bewußtsein wird dann als etwas erkannt, was nicht beim "Selber, sozusagen als sich selber, erlangten Zustand des absoluten, reinen Bewußtseins" endet, sondern es überschreitet die Grenzen/Begrenztheiten von Selbst und dem Denken in Begriffen von "mein Selbst", des anderen "Selbst". Alles wird in dem Lichte des  reinen Bewußtseins, in Begriffen des SELBST gesehen, wahrgenommen. Shankara sagte es dereinst in etwa so: "Im Vergleich mit dem Selbst ist Jener/Jene/Jenzwi//jenes Wesen/jenes Ding auch dasselbe Selbst, das SELBST"; jenes "transzendentale ,reine, absolute Bewußtsein" wird somit als etwas Eigenständiges erkannt, wahrgenommen, empfunden, gewußt. So wie man sich in der Wissenschaft vorzustellen pflegt, daß man selber auch nur aus demselben chemischen Kohlenstoff-Element , etc  besteht, so wird es für so jemanden (.. der das Eigenwesensein des "transzendentalen Bewußtseins" - per regelmäßiger tauglicher, angemessener, korrekter Meditationspraxis - wahrheitsgemäß, über jeden Zweifel erhaben, stets voll, kritisch- objektiv-fair geblieben gewesen seiend erkannt hat..) vorstellbar, daß diese Welt eine Art "Traumwelt" ist, eine Welt entstanden aus absolutem Bewußtsein ist und vom absoluten Bewußtseins stets allezeit und überall durchdrungen wird. Bisdahin ist die Befassung mit Gott belastet von allerlei Subjektivitäten, Irrtümern, falschen Vorstellungen, Täuschungen, Enttäuschungen, Vorurteilen usw. Erst ab dann und ab da kann so Manchem die Befassung oder auch ein Befaßtsein oder auch die Feststellung  des Befaßtseins mit Gott, GöttInnen, in Bezug auch sich selbst als Person - und nicht mehr nur als theoretische Überlegungen - erträglich erscheinen. Gleichzeitig endete der "Weg der Transzendentalen Meditation" beim "ich bin das, Du bist das, all dies ist das", beim Erkennen des Eigenwesenseins des absoluten, reinen, absoluten Bewußtseins. Es macht selbstverständlich auch weiterhin Sinn seine 30-minütige Meditationsübung fortzusetzen. Auch insofern ist "TM" keine religiöse Praxis. Wenn's jemand als das betrachten will, dann wird es für jene Person selber sowas letztlich, gemäß deren Hoffnungen und als Ausdruck deren Hoffnungen, sein sollen. Aber für so Jemanden wird auch die normale Arbeitswelt zu einer "religiösen Praxis", weil er alles ja aus "religiösen Absichten" heraus macht und aufgrund der Aspekte, die er/sie/zwi aus sein religiösen Gründen beachtete, eben nicht jede Tätigkeit machen wollte und nicht jeden Beruf ausüben wollte. Dennoch sagt man nicht, daß der normale Lehrerberuf eine "versteckte Gottesverehrung" sei odgl. Insofern ist eben jene Kritik an TM, wie sie vonseiten, - meines Erachtens - durchgeknallter oder auch Fanatismus erlegener oder einfach nur nicht objektiv-fair geblieben gewesener, evtl auch fehlinformierter oder auch mangelhaft informiert gewesener Personen  in den Mitte-70-er-Jahren tricksend plaziert und an den Mann zu bringen versucht wurde, zu Unrecht erfolgt und hatte bisweilen und zuallermindest in Einzelfällen leider schlimme "Verfolgungsausmaße" angenommen.



VERSE 13   O MOTHER, people there are who worship many other Devas than Thyself. They are greatly ignorant, and know nothing of the high truth, (but I) of  my own  uncontrollable desire for Thee  approach Thee, the Primordial Power, who dost deeply enjoy the great Bliss arising from union (with Śiva), and who art worshipped by Hari, Hara, Viriñci, and all other Devas.    

Vers 13:  Oh  Mutter, es gibt Leute, die vielen anderen Devas denn Dir selber Verehrung entgegen bringen. Sie sind schon sehr unwissend, verhaftet in Unwissenheit und wissen nichts von der erhabenen, großartigen Wahrheit; aber ich aus meinem eigenen von mir unbeherrschbaren starken Wunsch nach Dir suche Dich, nähere mich Dir, verlange nach Dir, nach Dir, der Kraft, die Form annahm als das Universum begann; ich bin Dir tief geneigt, die Du Dich der wunderbaren, großartigen Glückseligkeit erfreust, die aus der Einheit (mit Siva) herrührt; ich habe den starken Wunsch nach Dir, die Du verehrt wirst von Hari, Hara, Virinci und all den anderen Devas.


Anmerkungen des Übersetzers ins Deutsche:

Wenn jemand, transzendentales, reinen, absolutes Bewußtsein, Turyia noch nicht kennend, mit einem Mantra - etwa gemäß Swami Shantanand Saraswati's Lehre - zu meditieren beginnt, erscheint Ihm das Mantra oftmals wichtiger als das transzendentale Bewußtsein; es ist als wäre das Mantra "Selbstzweck" und nicht "Mittel zum Finden - vgl. die Begriffsbildung >> Schlaf finden << - des Turyia" . Solche Menschen verehren viele Devas, aber nicht das absolute Bewußtsein vermöge welchen sie Einheit mit Kali haben können (...so wie der Eisberg, ein Flüßlein, ein Strom, ein Bächlein, eine Regenwolke  usw alle Einheit mit dem Meer haben vermöge ihres Wasser seiens; eine Einheit, die das Meer nicht zu leugnen vermag so wahr all dieses Wasser irgendwie und irgendwann ins Meer mündet...); sie verehren die diversen Kräfte vermöge sie zu transzendieren meinen können und insofern verehren sie viele Devas. So wie Swami Shantanand Saraswati zum Ausdruck brachte, daß es nach dem Beginnen des Mantras der Geist erst mal von selber zur Ruhe zu finden beginnt, so ist jenes was dem Geist gestattet zu jener tiefen Ruhe zu finden - so wie man irgendwie weiß wie man einschläft - wie ein inneres Können, das einem wie eine Sehnsucht, ein Verlangen vorkommt, daß nicht eher aufhört bevor jene Ruhe, Turyia gefunden wurde. So wie René Descartes nicht ruhen konnte so lange er noch Grund zum Zweifeln fand und erst im "Oh, ich bin" (...jenseits aller Sinneswahrnehmungen, die auch Täuschungen hervorbringen hätten können; jenseits des Denkens, das Ihn täuschen hätte können, so wie man sich verrechnen kann; jenseits all der Sehnsuchtskräfte nach etwas was frei von Zweifel sei, da diese Kräfte Ihn auch noch in die Irre bringen hätten können, an Irrwege binden hätten können...) jene Ruhe jenseits seines Zweifelns und jenseits seiner Zweifel finden konnte, so findet jene Sehnsucht erst Erfüllung in jenem Einsein mit Kali vermöge jenes absoluten Bewußtseins, vermöge jenes Zustandes des Turyia, vermöge von Samadhi. So wie René Descartes voller Zweifel begann, sich immer wieder aufrappelte und es erneut versuchte, was Ihm am Vortag noch mißlungen war und letztlich noch nicht wissend, was Er suchte - weil er es ja noch gar nicht kannte und auch nicht wußte, daß es jemals erreichbar sein würde - und insofern "verlangend", "sich mehr oder weniger verzehrend sehnend", " igendwie wollend", (nicht wünschend, da man etwas, was man noch nicht kennt, nunmal nicht "wünschen" kann können; wer kann  sich vom "Weihnachtsmann" schon etwas "wünschen", das er gar nicht kennt?), "hoffnungsvoll suchend", so verlangen solche Suchende nach "Erleuchtung", nach "Unsterblichkeit", aber auch "religiöserweise nach einer für sie ungewußten, nicht wirklich gekannten Göttin Kali Suchende", obwohl sie letztlich nicht wissen was sie da suchen, wollen, erhoffen, insofern handeln sie aus schier nie enden wollendem, von ihnen selber nicht so recht beherrschbarem Verlangen. Es ist wie jenes mehr und mehr Geld Habenwollen, mehr-und-mehr sexuelle Erlebnisse-Habenwollen, mehr-und-mehr-Fachwissenhaben-Wollen, mehr-und-mehr mathematische Gesetzmäßigkeiten Wissen-wollen; da sagt einem der Verstand, läßt einem das bischen Mathematik (...das man zB am naturwissenschaftlich-mathematischen Gymnasium zumindest bis ca 1970 jedenfalls in Bayern gelehrt bekam...) ausrechnen, daß es in keiner endlichen Welt und also auch keinem zeitlich endlichen Leben jemals Erfüllung wird finden können. Jenes unbestimmte, von einem selber nicht so recht kontrollierbare Verlangen findet dann in jenem absoluten Bewußtsein und jener Einheit mit Kali jenseits allen Verlangens, aller Sexualität, allen Haben&Habenwollen, allen Fachkenntnissen, Axiomen, Formeln, Lehrgebäuden eine überraschende Lösung und Erfüllung.
Auf der anderen Seite sind da intellektuelle Konzeptionen, die einem eine Göttin Kali bzw jenes absolute Bewußtsein als etwas Reales erscheinen lassen so wahr man begründen kann, daß man die Unmöglichkeit seines Seins nunmal nicht begründen können kann, so wahr diese Welt eine Art Traumwelt sein könnte, es Wiedergeburt und auch insofern ein Gesetz des Karma geben könnte.
Es heißt "die Du verehrt wirst von Hari, Hara, Virinci und all den anderen Devas.". Es sind eben jene Laute Hari, Hara zusammen mit jenen Kärften, die jenes Findenkönnen von Turyia ermöglichen, so wie da etwas ist, was einem Schlaf finden läßt (...was man bisweilen erst ehrt, wenn man keinen Schlaf mehr zu finden vermag...) und insofern verehren sie jenes "Absolute Bewußtsein", "Samdhi", "Turyia" und insbesondere auch dem Nitya-Samadhi, jenem nicht mehr endenden Samadhi, dem Zustand der Ereluchtetheit, der wahren Erkenntnis der Wahrheit über jenes absolute Bewußtsein als eigenständiges Etwas, was man nicht nur selber ist und mit dem man sich Eins wissen kann ohne es jedoch in seiner Gänze jemals zu sein, weil man eben nicht der Andere ist, nicht Göttin Kali odgl ist und es außer jenem allem und allen Gemeinsamen auch noch die nicht minder bedeutungsvollen Unterschiede gibt, so wie die Welt des Wassers eben nicht nur aus einem wellenlosen Ozean besteht, sondern auch aus Wellenmustern, Verdunstung, Dunst, Regenwolken, Regen, Schnee, Hagel, Bächleins, Flüssen, Strömen, Seen, Wasserfällen, Kometenbestandteil usw. Letzteres sollte tunlichst nicht mißachtet werden, da es zu allerlei Problemen und Unerwünschtheiten betreffs des Alltag udgl führen kann oder auch könnte oder auch würde oder auch wird.

 Meditations-Fanatiker, TM-Fanatiker, Kunst-Fanatiker, fanatische Gurus, fanatische Priester usw,  politische, religiöse, wissenschaftliche, juristische, medizinische Fanatiker udgl mißachten eben genau jenes Letztere.


VERSE 14   O KĀLĪ, spouse of Giriśa, Thou art Earth, Water, Fire, Air and Ether. Thou art all. Thou art one and beneficent. What can be said in praise of Thee, O Mother? Of  Thy mercy show Thy favour towards me, helpless as I am. By Thy grace may I never  be reborn.

Vers 14 Oh Kali,  Ehegattin oder auch Seelengattin von Girasa, Du bist Erde, Wasser, Luft, Äther. Du bist alles. Du bist eins und wohltätig, gütig. Was kann man als Lobeshymne auf Dich zum Ausdruck bringen, o Mutter? Von deiner Gunst, deinem Beherrschen göttlicher Fügungen zeige mir, der nunmal hilflos ist wie er ist, deine Befürwortung meiner, lasse mich deine Unterstützung erfahren wennimmer Du es für vertrebar hältst. Infolge deiner Gunst und deines - soweit Dir möglichen - Engagements für mich, erspare mir jegliche weitere Gebundenheit ans Wiedergeborenwerden, lasse mich dem Kreislauf von Geburt und Wiedergeburt entrinnen.


Anmerkungen des Übersetzers ins Deutsche:

"Du bist Erde, Wasser, Luft, Äther. Du bist alles. Du bist eins" weist auf jenes alldurchdringende absolute Bewußtsein hin. Wenn man sich vorstellt, daß diese Welt eine Art Traum sein könnte (was man nunmal abstrakterweise grundsätzlich nicht ausschließen kann), so erscheint es offensichtlich, daß dann Erde, Luft, Wasser , Äther nichts als absolutes Bewußtsein sind. Analaog führt die Erfahrung von Turyia, das Finden von Turyia (vgl. : Man spricht von "Schlaf finden" und nicht von "Schlaf erlangen", "Schlaf erreichen"; andererseits spricht man von "Aufwachen" und "zu träumen anfangen",  einen "Traum haben" bzw schlichtweg von "träumen" zu jenem Wissen um solches "Einssein", zu jenem "ich bin das Du bist das , all dies ist das" und jenem "jenes absolute Bewußtsein ist ein eigenständiges Etwas, das jenseits seinerselbst eben auch existiert und nicht nur ein Teil, ein Eigentum von einem selber ist; zu jenem "Absolutes Bewußtsein gibt es nunmal schlicht&einfach"; göttliche Wese leben dabei jene Fülle des absoluten Bewußtseins, jenes Brahman. Wenn man selbst doch transzendentales Bewußtsein in jenem Zustand völliger Entspannheit erst erlebte und sozusagen in sich, dann irgendwann zur Erkenntnis kam, daß andere Wesen bei korrekter Meditation beim selben transzendentalen Bewußtsein ankommen (und es eben ein-und-dasselbe ist und nicht ein , sozusagen, in Teile zerhaktes absolutes Bewußtsein ist wo jene Teile unabhängig vonenander so vor sich hinexistieren täten.), dann lebt man insofern lediglich eine Teil jenes absoluten Bewußtseins, weil man nunmal ja ein eigenstäündiges Lebewesn weiterhin bleibt; der Baum bleibt ein Baum, die Krähe Busunda blieb und bleibt die Krähe Busunda, Rishi Vasishta blieb und bleibt Rishi Vasishta, usw. (....Die offenen Intervalle ]ai,bi[ mit bi=ai+1 und i durchlaufe alle (unendlich vielen) geraden ganzen Zahlen, also ....-8,-6,-4,-2,0,2,4,6,8,.... enthalten alle für sich überabzählbar unbendlich viele Elemente und die Menge aller reellen Zahlen enthält auch überabzählbar unendlich viele Punkte; dennoch bleibt ein grundsätzlicher Unterschied zwischen jenen dennoch beschränkten Intervallen und der unbeschränkten Menge der reellen Zahlen. In ihrer Unendlichkeit sind alle diese Intervalle eins mit der Menge der rellen Zahlen und dennoch sind und bleiben sie verscheiden von einander. Das sind nunmal Effekte der Unendlichkeit, die ja abendländischem Denken keinesfalls fremd sind. Man könnte sich dann, ansatzweise mal,  die Beziehung zwischen einem erleuchteten Menschen und einer Gottheit so ähnlich vorstellen als wie den Unterschied von so einem Intervall und der Menge der rellen Zahlen. In ihrer Unendlichkeit sind sie sich einerseits eins und dennoch bleiben sie wesensverschieden. Dabei kann man dann durchaus noch in Betracht ziehen, daß zB der Physiknobelpreisträger Werner Heisenberg von unendlichen Matritzen ausging und insofern von Art unendlich dimensionaler linearer Vektorräumen. Insofern würde also dann Platz genug sein für unendlich viele Gottheiten, Götter/Göttinnen/Göttzwis und erst in ihrer gesamntheit würden sie diese Welt sozusagen "aufspannen", also "erhalten", darstellen", "geschaffen haben , erhalten und irgendwann wieder auflösen"...).

Wenn doch diese Welt eine Art Traum ist, so kann es doch  - frei nach Rishi Vasishta - keinerlei Grund geben den "Traum" eines Individuums zum grundsätzlich Schlechteren zu wenden. (Die TM-Technik, die dereinst nur in einer Weise gelehrt wurde, daß damit untrennbar die Mitgliedschaft in einem Verein verbunden war, setzte sich leider genau darüber hinweg, wenn sie zB einen Minderjährigen initiierte - wie mich dereinst 1971 - obgleich weder er noch seine Eltern das wollten und obwohl der betroffene Minderjährige schon einmal eine Vereinsmitgliedschaft  - beim mir beim TSV 1860 München, Leichtathletikabteilung - beendete - und dazu extra dann nochmals nachhaken hatte müssen, weil es gewisse Vereinsmitglieder nicht hatten zur Kenntnis nehmen wollen -, weil das Vereinsleben ihn in wesentlichen, berechtigten, gut-möglich-genugen Interessen, dem Lernen und Vorbereiten auf gut-möglich-genuge Karriere grundsätzlich beeinträchtigte.(So wundert es nicht, daß ich mich von der TM-Vereinsmeierei belästigt fühlte und schlimme Nachteile, sogar zu erwartenderweise, bekommen hatte). Gerade auch wegen meiner schlechten, unangenehmen Erfahrungen in Bezug auf Vereinsleben, hatte ich eben TM damals nicht erlernen wollen. Nur jener deutsche Deutschlehrer hatte es gewollt bzw mein Dorthingehen mit dem Text "ich müßte das noch wegen jenes Schulreferates lernen, weil noch gewisse Fragen offengeblieben waren" erzwungen. Mußte die TM-Vereinsmeierschaft dann es auch noch - per jenem gewaltsamen mir "Mitgliedschaft-Verpaßthaben" - ausprobieren, ob das meiner Karriere, etc wirklich schaden sollte können? Mußte ein deutscher Deutschlehrer, mich auch noch per Notendruck in jene Scene schicken, die ich bereits aus eigener Entscheidung heraus abglehnt gehabt hatte? Nun, das mußten jene gewiß nicht und schon gleich nicht in der "freiheitlichen" BRD. Dabei muß die Frage eigentlich ja auch heißen "durften jene das tun?". Nunja, die Antwort des Mr. Mahesh hatten jene vorab bereits gewußt und sie lautete "nein". Leider wollte die deutsche Justiz das der TM-Vereinsmeierei und jenem deutschen Deutschlehrer nie schriftlich, dh in Form ein Gerichtsurteils, geben. Der einzige Grund für diese Untätigkeit der Justiz dabei kann dabei sowas wie "Korruption", "schreckliche Schlamperei mit nachfolgendem brutalen,  vorsätzlichem Aussitzen" udgl sein. Ein etwaiges "Einssein" mit absolutem Bewußtsein und insofern mit Kali oä, hat mich dabei noch nie belästigt und mir auch nie geschadet und jene abstrakten Theorien ebenso wenig. Nunja jener staatliche, verbeamtete deutsche Deutschlehrer war ja auch noch Sportlehrer der Jungens gewesen und insofern ja vielleicht wirklich Obervereinsmeierei-Anhänger und wollte da andere mit seiner Vereinsmeierei, ohne Rücksicht auf Katastrophen, zwangsbeglücken. Nunja, als ich - aus Einblickerlangthaben in die Gefährlichkeit einzelner TM-'lerInnen - heraus die TM-Scene verließ, galt sie immer noch als gemeinnützig&besondersförderungswürdig; wer aber zwangs-vereinsmitgliedschaftet hatte, war nun wirklich weder gemeinnützig noch besonders förderungswürdig gewesen.



VERSE 15   HE, O  Mahākālī, who in the cremation-ground, naked, and with disheveled  hair, intently  meditates upon Thee and recites Thy  mantra, and with each  recitation   makes  offering  to  Thee  of  a  thousand  Ākaṇda  flowers with  seed,  becomes without any effort a Lord of the earth.

Vers 15  Gott, Oh Mahakali, wer am Begräbnisort, nackt und mit unfrisiertem Haar, konzentriert (gesammelt) im Bezug auf Dich meditiert, dazu dein Mantra reziert und bei jeder Rezitation, Wiederholung deines Mantras Dir tausend Akanda-Blumen mit Samen anbietet/übergibt, sojemand wird ohne Anstrengungen ein Herr der Erde, eine bedeutende und Einfluß- ausüben-könnende Persönlichkeit auf Erden.


Anmerkungen des Übersetzers ins Deutsche:

Bei "tausend Akanda-Blumen mit Samen anbietet/übergibt"  geht es wohl um den sog. "tausenblättrigen Lotus". Wer regelmäßig korrekt meditiert (vgl. etwa  "Sayings of Swami Shantanand Saraswati") in Richtung mehr und mehr Entspanntheit gemäß seiner/ihrer/döszwi natürlichen Motivation anstrebend, dabei transzendierend, dh über mehr und mehr Entspanntheit jenen Zustand des Turyia findet, der hat Mahakali "tausend Akanda-Blumen mit Samen angeboten/übergeben. Dabei bedeutend "mit Samen" dann eben, daß es zu jener Transformation beiträgt/führt, wie es Swami Shantanad Saraswati darlegte. Wieso Mahakali angeboten/übergeben? Nunja, weil sie wegen ihrer Unsterblichkeit auch eins (in perfekter Harmonie) damit ist und jenes absolute Bewußtsein, ewiger Samadhi auf natürliche Weise wesentlicher Aspekt ihres Lebens ist (...auch wegen des Begriffs "Gott", der in Bezug auf Sie angewandt wurde..).


Wer korrekt meditiert, dabei Kleidung, Ort und sein Aussehen/ "Sich-Hergerichtethaben" vergißt, erreicht im Zustand transzendenter Entspanntheit, jenem Zustand des Turyia, daß die subtilen Aspekte seines Lebens Beachtung finden, da so jemand per permanentem Streben nach Erfüllung irgendwelcher Wünsche, angestrebter Ziele in Bezug auf die äußere Welt, Reichtum, Karriere, Ansehen, Erfolg den weltlichen Dingen verhaftet seiend, dann wenigstens für jene Zeiten der Meditation Rücksicht nimmt auf sein umfassenderes Selbst, auf Wahrheiten wie, daß man auf Erden niemals wird unendlich viel Geld, Bücher, Kunstwerke, kleine schöne unnötige Dinge, Pokale, Urkunden usw wird haben können. In jenem Sinne öffnet sich dann der "tausendblättrige Lotus" wenigstens für jene  kurzen Momente und es kommt so im Zuge des Vertrautwerdens mit jener natürlichen umfassenderen Weltsicht, jenem umfassenderen Erleben, das aus dem Finden jenes Zustandes von Turyia resultiert allmählich zu einer Transformation hin zu einem Leben in Harmonie mit der eigener umfassenderen Natur als auch der Wesen außerhalb von einem selber bzw auch der Natur schlechthin. Schließlich wird das Leben dann in natürlicher Weise nicht mehr nur als etwas gelebt, was aus einer Abfolge von Wachen, Träumen und Schlafen mit einem Anfang (Geburt) und Ende (Tod) besteht; zumindest ist es sehr bald eben keine blose Abfolge von Wachen, Träumen und Schlafen mehr und das was man bislang als "man selbst" zu bezeichnen pflegte, ist insofern dann ein größeres Selbst, das zu Recht geahnte oder auch gewußte SELBST geworden. Allerdings war lediglich die Sichtweise des was man für "man selbst" zu halten pflegte beschränkt und insofern wurde man kein "weiteres, umfassenderes SELBST", sondern legte lediglich eine "Unwissenheit" ab. (... Der Versuch der Psychiatrie, Psychologie, Juristerei mit einem korrupten Verhältnis mit der Psychiatrie alles auf Abfolgen von Wachen, Träumen und Schlafen zurückzuführen und weder Turyia noch SELBST wahrhaben zu wollen ist wie der vergebliche Versuch eine 4-dimensionale Welt als 3-dimensional jedermann einzubleuen zu versuchen oder wie das absurde Unterfangen der Vergangenheit, die Welt als "Scheibe" mit einem endlichen Rand und endlicher Ausdehnung  jedermann vorzuschreiben. Irgendwann flog dann doch tatsächlich ein Papst problemlos quer über die Erdkugel; aber zuvor mußten lächerliche und brutale VertreterInnen der Kirchen alle brutal verfolgen, die das für sinnvoll und wahr gehalten hatten. Der versuch "Meditation" wenigstens in die angeblich dafür komptentenen Hände der, nochdazu, Tierversuchemacherei-Medizin zu legen, ist Ausdruck erbärmlicher Unwissenheit und skrupelloser wie törichter Besserwisserei sowie maßloser, Täuschung verhafteter,  Eingebildetheit...)


Bei der sinnvollen Meditation gibt es durchaus subtile Unterschiede je nach dem ob jemand von einem nach tiefster Entspannung-Streben oder aber auch nach Tiefster-Ruhe-Streben oder aber auch nach Schönstem-Streben gemäß seines Naturells ausgeht; das hat nunmal mit der Individualität Meditierender zu tun. Im Endeffekt ist's egal, aber für den Einzelnen ist es eben nicht egal, ob die Meditation pro Erlangung tiefstmögliche Ruhe, größtmöglichem inneren Frieden, größtmöglicher Wachheit&Aufnahmefähigkeit, usw betrieben wird. Je nach Individualität interessiert sich eben jemand für tiefstmögliche Ruhe oder aber doch eher für größtmöglichem inneren Frieden. Letzteres könnte eben ein akzeptabler Ansatz für den einen oder auch anderen Christen sein, ersteres evtl für von Rastlosigkeit geplagte UnternehmerInnen, usw. Kali als Göttin der Zeit wird dabei eben für den einen oder auch anderen Menschen der natürliche Ausgangspunkt sein und irgendwann könnte so jemand dann sich dieses Sachverhalts natürlich, ungezwungen und wahrheitsgemäß gewahr werden. So jemand mag dabei vorab gar nicht wissen, daß das mit "Verehrung von Kali" letztlich zu tun hat bzw letztlich bereits richtige Kali-Verehrung ist, was er da als seine leitende Grund-Idee für sein Leben, worauf Er immer wieder zurückgreift, tut. Durch korrekete Meditation mag sojemand eben auch der Wahrheit in Bezug auf solche Gegebenheiten wahrheitsgemäß näher kommen und zwar ohne daß es zu einem Durcheinander der Gefühle usw kommt. Insofern sind eben Unvoreingenommenheit, Natürlichkeit, Mühelosigkeit im Zusammenhang mit richtiger Meditation von grundsätzlichem Wert. Insofern kann es wohl, allgemein geäußert, nicht schaden, sich mit diesem Text "Kalikarpuradastotra" - auch als Einzelbeispiel für die anderen Fälle - befaßt zu haben.

Wenn jemand nicht korrekte Meditation übt und daher nicht den Zustand von Turyia findet, dabei bleibt, daß die Welt des Wachens, Träumens und Schlafens die "ganze Welt ist", der kennt nur jenes "selbst", das insbesondere das ist, wofür er/sie/zwi sich im Wachzustand hält. Jenes natürlicherweise zeitlose SELBST-Sein, welches sich einem mit dem Finden von Turyia bietet, das wegen seiner Zeitlosigkeit sehr anders ist als jenes, an das Wachsein gebundene "man selbst", wird per korrekter Meditation zu einem natürlichen Teil des eigenen Lebens und zwar, aufgrund seiner Zeitlosigkeit, von fundamenaler Bedeutung.


VERSE 16   O KĀLĪ, whoever on Tuesday at midnight, having uttered Thy  mantra, makes offering even but once with devotion to Thee of a hair of his Śakti in the cremation-ground, becomes a great poet, a Lord of the earth, and ever goes mounted upon an elephant.

Vers 16  Oh Kali, werauchimmer am Dienstag um Mitternacht, dein Mantra aktiviert oder auch ausgesprochen habend, immerhin wenigstens einmal mit Vertrauen, Hingabe an Dich dir ein Haar seiner Shakti im Grund der Feuerbestattung überläßt, wird ein großer Poet, eine bedeutende Persönlichkeit auf Erden und schreitet immer, auf einen Elefanten gesetzt, umher.


Anmerkungen des Übersetzers ins Deutsche:

"Oh Kali, werauchimmer am Dienstag um Mitternacht", heißt es im Vers 16: Wenn man doch von "Göttin der Zeit" ansatzweise ausgeht, man Zeitlosigkeit anstrebt, die Zeitlosigkeit und deren Eigenschaften sowie Auswirkungen gar nicht kennend, so wird man auch in Betracht zu ziehen haben, daß es für einen selbst da ja zunächst doch mal gewisse Zeitpunkte so wie der und der Tag um die und die Uhrzeit gibt oder auch - wenn man etwas von Shankara, Vyasa, Vasishta  gelesen hat - zumindest zu geben scheint und für eine selber eine gewisse Bedeutung und Realität hat und deshalb das oder auch Anderes einem bedeutungsvoll erscheint. Dabei mag es dann für Kali, Zeitlosigkeit finden udgl in Wirklichkeit völlig egal sein, wann und wo so jemand da endlich mal "vernünftig, richtig meditiert", Hauptsache  er/sie/zwi macht's. Dabei ist es allerdings auch nicht völlig egal was man zwecks "endlich mal Anfangen" macht. Dafür extra zu roden, schlachten, tierversuchen, umweltvergiften oder auch andere Greueltaten zu begehen, würde widersinnig sein, nutzlos, nur schädlich für das Finden, Erlangen von Turyia, Samadhi und zwar so ähnlich als wie wenn die Kriminalpolizei Indizien vernichtet, den Tatort erst mal willkürlich oder auch ungeschickterweise völlig durcheinander bringt, Etliches an Beweismaterial oder Entlastungsmaterial verschwinden läßt bzw unwiderbringlich zerstört und dann Solches in der irren Meinung tat, daß es der Wahrheitsfindung irgendwie dienlich sein "würde" können. Solche Greultaten stellen könen nicht geeignet sein, der Wahrheitsfindung, Turyia, Samadhi zu dienen; es ist ganz im Gegenteil genau das, was es verhindert; es ist wie wenn man das Leiden, den Tod, den Kreislauf von Geburt&Wiedergeburt loswerden möchte und sich aber mit beiden Händen und aller Kraft ans Leiden, den Tod, den Kreislauf von Geburt & Wiedergeburt klammert, es festhält so fest man nur irgendwie kann und allenfalls noch was tat/tut, um die Kraft zumFesthalten von Leiden, Tod, Geburt & Wiedergeburt zu erhöhen, dh die Widersinnigkeit seins Tuns noch zu intensivieren.

Wenn man dann diesen Vers mal in Relation zu Swami Shantanand Saraswati's Ausführungen bzgl Meditation setzt, erhält man Folgendes:
Der Teilsatz "dein Mantra aktiviert  oder auch ausgesprochen habend," bezieht sich auf das Anfangen mit dem Mantra.
Der Teilsatz "immerhin wenigstens einmal mit Vertrauen, Hingabe an Dich" bedeutet dabei, daß der Prozeß des Meditierens, jenes zur völligen Ruhekommens dann natürlicherweise erstmal wie von selbst abläuft:
Erstmal muß man eben beginnen: >> Falls wir, in der Meditation, nachdem wir mit dem Mantralaut begonnen haben<< und insofern "dein Mantra aktiviert  oder auch ausgesprochen haben,"

Swami Shantanda Saraswati schreibt weiter:

>> Falls wir, in der Meditation, nachdem wir mit dem Mantralaut begonnen haben, anfangen nach irgendwas Ausschau zu halten, vielleicht einen Ton oder auch eine Substanz, haben wir aufgehört/sind dabei aufzuhören zu Meditieren, machen wir was im Widerspruch zur Meditation. Selbst das Reden von "Wertschätzung" ist Dualität. In tiefer Meditation betreiben wir nicht einmal Wertschätzung von Friede, Wahrheit, Glückseligkeit oder auch Bewußtsein; tatsächlich werden wir friedlich, wahrheitsliebend, glückselig und unseres SELBST bewußt. Man muß alle Ideen des Wertschätzens in Bezug auf das Mantra aufgeben. Das Mantra wird auf natürliche Weise in jener Einheit zu jener Ruhe  kommen in der es keine Aktivität und Unterteilheit gibt.<<.

Da sieht man dann ja schon einen gewissen Zusammenhang zum vorliegenden Vers ", Hingabe an Dich dir ein Haar seiner Shakti im Grund der Feuerbestattung überläßt". Die ganze Welt skuriler Gedanken, größtmöglicher Wertschätungsaufwallungen, Gefühlsaufwallungen, Sich-Abringen-Tätigkeiten udgl hat Swami Shantanand Saraswati ja angesprochen bzw besprochen wie man damit umgehen müßte, wenn's vernüftig sein und werden solle. Es geht darum, erstmal Abstand zu nehmen von so Ideen wie ", Hingabe an Dich dir ein Haar seiner Shakti im Grund der Feuerbestattung überläßt", von sowas wie "Ich gebe Dir" und "dafür gibst Du mir", von Dualität.

Allerdings, wenn man mal obigen Vergleich mit Polizeiarbeit heranzieht, so ist der Ort der Feuerbestattung nunmal ohne Pflanzenbewuchs und dort ein verlorengegangenes Haar zu bestatten wird kaum irgendeinem Lebwesen, ob Regenwurm, Gräslein odgl Schaden zufügen, weil der Ort eben so fürsorglich-liebevoll-rücksichtsvoll gewählt ist. Insofern hätte sojemand vielleicht ja Unnötiges, wenig Hilfreiches, unnötig Zeit damit verbringend getan, aber es würde seiner Beziehung zur Welt von GöttInnen, falls es jene nunmal geben sollte, keinen Abbruch tun. So jemand hätte gehandelt gemäß jenem Altbekannten Prinzip "Hilft evtl nichts, schadet aber auch nichts und niemandem; also kann man den Versuch mal wagen, da es ja evtl ja doch was hilft".


>> Falls wir, in der Meditation, nachdem wir mit dem Mantralaut begonnen haben, anfangen nach irgendwas Ausschau zu halten, vielleicht einen Ton oder auch eine Substanz, haben wir aufgehört/sind dabei aufzuhören zu Meditieren, machen wir was im Widerspruch zur Meditation. Selbst das Reden von "Wertschätzung" ist Dualität. In tiefer Meditation betreiben wir nicht einmal Wertschätzung von Friede, Wahrheit, Glückseligkeit oder auch Bewußtsein; tatsächlich werden wir friedlich, wahrheitsliebend, glückselig und unseres SELBST bewußt. Man muß alle Ideen des Wertschätzens in Bezug auf das Mantra aufgeben. Das Mantra wird auf natürliche Weise in jener Einheit zu jener Ruhe  kommen in der es keine Aktivität und Unterteilheit gibt.<<

Da sieht man dann ja schon einen gewissen etwaigen Zusammenhang zum vorliegenden Vers ", Hingabe an Dich dir ein Haar seiner Shakti im Grund der Feuerbestattung überläßt". Die ganze Welt skuriler Gedanken, größtmöglicher Wertschätungsaufwallungen, Gefühlsaufwallungen, Sich-Abringen-Tätigkeiten udgl hat Swami Shantanand Saraswati ja angesprochen bzw besprochen wie man damit umgehen müßte, wenn's vernüftig sein und werden solle. Es geht darum, erstmal Abstand zu nehmen von so Ideen wie ", Hingabe an Dich dir ein Haar seiner Shakti im Grund der Feuerbestattung überläßt", von sowas wie "Ich gebe Dir" und "dafür gibst Du mir".

Andererseits werden Endlichkeit und Sterblichkeit in dieser irdischen Welt, dieser Welt des Samsara angesprochen und es kommt zum Ausdruck, daß eine noch so große Verehrung für eine eigene Freundin stets den Makel hat, daß man etwas Vergängliches verehrt und lediglich in jener Erkenntnis "Ich bin das, Du bist das, all dies ist das" würde so eine Verehrung dann entscheidend an Wahrheitsgehalt gewinnen, von Wahrheit getragen werden und insofern eine gewisse Zeitlosigkeit erlangen können. Zweifelsohne haben Endlichkeit und Sterblichkeit abermals etwas mit dem zu tun, wie unwissenden Wesen, Zeit als Zeitlichkeit, Vergänglichkeit, Unheilschwanger mit Tod als Endpunkt erscheint, dh jenem "Verrinnen der Zeit des (aktuellen) Lebens auf Erden".


Nunja, andererseits muß man aus einem gewissen Vertrauen heraus handeln, da man das SELBST ja noch gar nicht kennt; schließlich müßte man ja nicht derart meditieren, wenn man's schon realisiert hätte. Allerdings gibt's dummes Vertrauen im Sinne von Hazadeurhaftigkeit; es gibt aber auch "Geschicklichkeit angesichts des Erfordernisses etwas nicht zu wissen und insofern Vertrauen-Müssens", dh  der, vorab statt zu finden habenden, Suche nach einer geeigneten "Strategie".
Swami Shantanand Saraswati hat nun eben genau darauf hingewiesen, daß große Wertschätzungsgefühle udgl für das Mantra usw keinesfalls von Nöten sind und damit ist man auch nicht in jener Gefahr, von welcher jene Sektenbeauftragten wie Pfarrer Haak und andere ständig zu wissen behaupteten.

Swami Shantanand Saraswati weist dabei auf 2 Sachverhalte hin und wie man damit vernünftigerweise umgeht:
a) >> Selbst das Reden von "Wertschätzung" ist Dualität. In tiefer Meditation betreiben wir nicht einmal Wertschätzung von Friede, Wahrheit, Glückseligkeit oder auch Bewußtsein; tatsächlich werden wir friedlich, wahrheitsliebend, glückselig und unseres SELBST bewußt. Man muß alle Ideen des Wertschätzens in Bezug auf das Mantra aufgeben. Das Mantra wird auf natürliche Weise in jener Einheit zu jener Ruhe  kommen in der es keine Aktivität und Unterteilheit gibt.<<

b) Gedankliche Aktivitäten während des Meditierens einerseits und Anwandlungen von Hingabe, Gefühlsaufwallungen & co andererseits:
>>Wenn man in einer ruhigen Position zur Meditation sitzt, mag es Ablenkungen von außen geben und diese Zerstreuungen,Verwirrungen, Ablenkungen ziehen den Geist an. Man beachte sie nicht. Abgesehen von äußeren Ablenkungen gibt es innere Tumulte! Diese hören nicht auf im Geist weiterzugehen/als geistige Aktivität in Erscheinung zu treten; er/sie, der Geist kehrt/die geistigen Aktivitäten kehren immer wieder zurück zu gewissen Dingen, die er tun möchte/die man tun will - es zeigt einem lediglich verschiedene "Ordner" für die eigene Betrachtung! Wenn man fast ruhig,still ist, kann diesen Einordnungen mehr Energie zuteil werden und deshalb wird man vom Geist/den geistigen Aktivitäten dahin zu bewegen versucht, es sich anzusehen. Tatsächlich ist es aber so, daß jetzt nicht die Zeit dafür ist; also treffe man eine Entscheidung - sei Dir im Klaren darüber/ mache dem Geist klar bzw kläre die geistigen Aktivitäten dahingehend , daß es nicht die Zeit für diese Einordnungen ist - "Wenn ich meine Zusammenkunft mit dem SELBST beendet habe, werde ich mich um jene zweifelsohne kümmern!" Dann befasse dich mit jenen Betrachtungen später, Lösungen bezüglich jener Fragen suchend, die den Geist zu beschäftigen scheinen. Dies ist der Weg: Man bestelle ihm was zu tun ist. Er wird den eigenen Anweisungen folgen, vorausgesetzt die Anweisungen gehen von einem aus oder auch, anders ausgedrückt, man steuere die geistigen Aktivitäten und es wird das Angesteuerte eintreten, vorausgesetzt nunmal, daß man sie steuert. Man treffe eine Entscheidung, man lasse ihn am Eingang/Tor sein und ihm sagen, keinerlei Einordnungstätigkeiten zu einem vorzulassen weil jetzt dafür nicht die Zeit ist. Man wird sich später damit auseinandersetzen. Und dann befasse man sich später auch damit.<<

Kurzum Swami Shantanda Saraswati empfiehlt mit den Gedankeninhalten dann außerhalb der Meditation sich ganz normal zu befassen und man kann sich fragen, was dann also an so einer Meditation schon gefährlich sein sollte können.

Zweifelsohne hat jemand der mit Meditation anfängt so seine Ideen im Zusammenhang damit und jene Ideen werden ihn durch die Meditation bis zu einem gewissne Grad begleiten, weil sojemand ja, wenn  keine Idee bzgl Sinnvollkeit des Meditierens an sich mehr da wäre, ja aufhören würde. Allerdings wird eben es in der Meditation um das zu gehen haben, was jenseits seiner Ideen, Gedanken, Hoffnungen, Fantasien odgl liegt; es geht um jenes zur Ruhekommen und in Momenten jener Ruhe ist dann die Idee des Zurruhekommen-Sollens/~Wollens selbst zur Ruhe gekommen und darin liegt bereits jene Wahrheit, wonach eben in jenen "Dingen", die man selber nunmal nicht ist, wie Ideen, Gedanken usw auch tief innen jenes absolute Bewußtsein ist, daß auch sie nichts wie Ausdrucksformen jenes absoluten Bewußtseins sind. Insofern läuft also während des Meditationsvorgangs da etwas parallel zum "Mit-dem-Mantra-begonnen-Habens" und genau das wird in diesem Vers auch ausgedrückt; es kommt dabei auch zum Ausdruck, das das was da als "leitende Idee" parallel läuft, eben durchaus auch eine "reine Idee" sein kann und wohl, im Sinne dieser Lobeshymne auf Kali, dringend angeratenerweise auch ist.
 

Wer sich so einer obigen "reinen Idee", die einen während der Meditation nunmal leitet, befleissigte, sich wenigstens mal die Zeit nahm oder auch Mühe machte das zu begreifen, der hat sicherlich Wesentliches der Poesie verstanden und weiß der Welt etwas zu sagen. Solches drückt der Vers dann eben auch, erfreulicherweise, aus.


Der Abschluß des Verses, jene Metapher "und schreitet immer, auf einen Elefanten gesetzt, umher", hat mindestens 2 Aspekte:

a) Auf dem Rücken eines Elefanten ist man sicher vor wilden Tigern udgl.

b) Elefanten, diese wunderbaren, großartigen Geschöpfe trampeln keinesfalls alles kuz&klein; nein sie bilden schmale Trampelpfade auf denen sie Wanderungen unternehmen.

c) Gegründetsein in Ruhe inmitte des Handelns (vgl. die entsprechenden Verse der Bhagvad Gita)


VERSE 17   THE  devotee who, having placed before himself, and meditated and again meditated upon, the abode, strewn with flowers, of the Deva with the bow of flowers, recites Thy Mantra, Ah! he becomes on earth the Lord of Gandharvas, and  the  ocean  of  the  nectar  of  the  flow  of  poesy, and  is  after  death  in  Thy  supreme abode.

Vers 17 Jawohl, ein hingebungsvoll Suchender, der dein Mantra rezitiert - dabei sich auf die, mit Blumen übersähte Wohnstatt des Devas vor dem sich die Blumen verneigen ausrichtet und immer wieder von dieser Ausgangssituation aus meditiert, diesen Gedanken nunmal nebenher hat - wird auf Erden jemand, dem Gandharvas zu Diensten sind, erfreuen können; sojemand wird jemand, dem der Nektar-Ozean des Quellens und Fließen der Poesie dienlich sind, der Zugang dazu hat und der nach dem Eintreten des Todes in deiner höchsten Wohnstatt weilt.

Anmerkungen des Übersetzers ins Deutsche: 

Wie in meinen Anmerkungen zum vorherigen Vers ausgeführt, hat jemand der Meditation praktiziert nunmal so eine gewisse leitende Idee, zB möglichst tiefe Ruhe erlangen wollen, tiefstmögliche Entspannung erreichen wollen, sich in Ordnung bringen wollen, auch noch Meditations-Können erlangen wollen, Wissen über Meditationsbereich erlangen wollen, Frieden finden wollen, Verachtung udgl  in Schranken halten wollen (vgl so wie eine Motivation gemäß des  "Eiserner Rosenkranz des Feldherrn Tilly), KünstlerInnen geht da eben im Zusammenhang damit etwas anders durch den Kopf als wie WissenschaftlerInnen, PhilosophInnen, MathematikerInnen, InformatikerInnen, SprachwissenschaftlerInnen, UmweltschützerInen usw, sie leben als Künstler, Mathematiker etc vor dem Meditieren und nach der Meditationsitzung, haben dabei jeweils unterschiedliche eventuell ja unerfüllbare Ansprüche ans Meditieren. Ingenieure udgl werden da eher an jene Barriere stoßen, daß sich "alles was machbar ist, muß und darf auch gemacht werden, wenn's der eigene Staat nur erlaubt" nicht mit den yogischen Idealen (...und jener "Transformation", welche Mr. Mahesh als "Einströmen des Seins" bezeichnete bzw was er mal darstellte als "es ist wie das Ziehen an einem Tischbein eines Tisches mit 8 Beinen; man zieht an einem Tischbein - Samadhi im Falle von TM - und der ganze Tisch  - also auch Gewaltlosigkeit, Nicht-Heftigkeit, Reinheitsthemen wie also auch Sauberhalten der Natur, Nicht-Giftmüll-Produzieren, Nicht-Atommüll-Produzieren, Nicht-Roden, Nicht-Gewässerverschmutzen usw kommen daher...) vereinbar sind, was dann Zurfolge hat, daß sein meditieren irgendwie von "Seltsamkeit", in gewisser Weise von "Widersprüchlichkeit" geprägt sein wird und evtl in gewisse Hilflosigkeits- und Ausweglosigkeits- sowie, formal denkenderweise, Unzufriedenheitszuständen führt, das dann in Staaten wie Deutschland leicht noch zu brutaler Verfolgung durch die, aufgrund der Unwissenheit, Vorurteile , Nicht-Erleuchtetheit der PsychiaterInnen und insofern derer Psychiatrie führt. In zB Rußland gibt es keine zwangsweisen ärztlichen  Behandlungen, berichtete mal die SZ im Zusammenhang mit dem genialen Mathematiker Perelmann, sodaß man dann in jenem Zustand gewisser Hilflosigkeit seinen Beruf auszuüben wenigstens nicht auch noch verfolgt wird und zum allmählich Selber-Heraufinden die Zeit und Gelegenheit hat. So nähern sich unterschiedliche Menschen sozusagen von unterschiedlichen Seiten her alle demselben Ziel, jenem absoluten, transzendenten, reinen Bewußtsein und damit einhergehend jenem Zustand des Samadhi, jenes Turyia. Dabei erweisen sich dann erlangte Zeitlosigkeit, Raumlosigkeit  und Schwerelosigkeit als jeweils vom Wesen her dasselbe, als jenes eine absolute, transzendente, reine Bewußtsein, das in seiner Fülle überall ist.

Wieder aus der Meditation in den Alltag zurückkehrend wird eben jemand mit eher künstlerischem Lebensweg Posei udgl als bereichender empfinden als wie zu seinen Zeiten ohne Meditation und das schlichtweg deshalb, weil es eben auch Menschen gab und gibt, die erfolgreich, korrekte Meditation praktizier(t)en und wegen der umfassender Weltsicht und dem umfasenderen Wissen über Bewußtsein udgl dann eben eine umfassender, tiefgründigere Poesie verfaßten bzw Kunst schufen und sojemand, der nun selber korrekte Meditation praktiziert, diese tiefgründigeren Werke jener Dichter nun ebenfalls wertschätzen könnend, nicht mehr so leicht von schein-gescheiten AutorInnen in immer dieselben Kreisläufe von in Euphorie geraten durch Getäuschtwerden, Täuschung und Enttäuschung - aus zB Geldmachabsichten - verleitet werden. Der Kunsterzieher, den ich 8 1/2 Jahr lang am Gymnasium hatte, OStR Dieter Stöver, wies mal darauf hin, daß es KünstlerInnen gibt, die Drogen nehmen, dann dadurch Sinnestäuschungen durchleben oder auch erleiden, anschließend einfach nur das Malen, was jene Sinnestäuschungen hervorgezaubert hatten und daß man das ja nun wahrlich nicht mehr als "Kunst" bezeichnen könne; er sprach dabei auch von solchen Freunden seinerselbst. "KunstliebhaberInnen" fallend dann auf solche "Kunstwerke" allzuleicht herein, wenn sie nicht gerade von jemand wie Herrn Stöver vom kompteneter Seite aus davor zumindest gewarnt worden waren. Auch der Autor  des Films "David wants to fly" wies in senem Film auf gewisse Drogenproblematiken gewisser "Erleuchtungsstrebender" dankenswerterweise ausdrücklich hin.

"Nach dem Eintreten des Todes" kann zweifelsohne und ist, seriöse-, wahrheitgerechtwerdenwollenderweise umfassender zu sehen: Was wenn diese Welt eine "Art Traum" wäre? Nunja, der Tod in dieser Welt wäre das Aufwachen in der wirklichen Welt. Wenn also jemand eben in jener Welt von Zeit, von Kali natürlicherweise lebt, so wird sojemand dort auch wieder aus irgendwelchen Träumen aufwachen. Den Kreislauf, des immer wieder auch Alpträume-Durchleidens, überwindet so jemand eben durch korrekte Meditation und irgendwann wird er, endlich angemessen an sein eigentliches, wahres, wirkliches Zuhause, nie wieder Alpträume haben, er wird Erleuchtung und Unsterblichkeit erlangt haben, nicht mehr verwickelt seiend in Wachen,Träumen und Schlafen durch die Realisation von nitya-samadhi, dauerhaftem Samadhi, ein Leben aus der Realität von Wachen-Träumen-Schlafen-und-Turyia lebend. Insofern wird sojemand, dann endlich jene Wohnstatt voller Glückseligkeit, Freude, Leidfreiheit, Glück, "Poesie" und "erfreulichster sowie erfreuenster Gesangskunst" nie wieder verlassen, dh endlich wird sojemand dort wirklich, dh für immer, dh zeitlos, dh vereint mit Zeitlosigkeit und insofern für immer vereint mit der Göttin der Zeit, mit Kali , das Strömen von Zeit endlich ungetrübt genießen könnend, angelangt sein.


VERSE 18   HE who at night, when in union with his Śakti, meditates with centred mind on  Thee, O Mother with gently smiling face, as on the breast of the corpse-like Śiva, lying  on  a  fifteen-angled  yantra deeply enlisted in sweet  amorous play with Mahākāla, himself becomes the destroyer of the God of Love.  


Vers 18   Wenn jemand des nachts, vereint mit seiner Śakti, mit gesammeltem auf Dich gerichteten Geist meditiert, meditiert in Bezug auf  Dich Oh Mutter mit sanft lächelndem Gesicht, als seiend auf der Brust eines als Leichnam vorgestellten  Śiva, der auf einem 15-fach verwinkelten Yantra liegt und, Mahakala verpflichtet seiend, tief versunken ist ins süße Liebesspiel mit Mahakala,  wird selber zum Überwinder des Gottes der Liebe.

Anmerkungen des Übersetzers ins Deutsche:

", meditiert in Bezug auf Dich Oh Mutter mit sanft lächelndem Gesicht, ":  Auf diese Begleitgedanken, natürliche, dem Einzelnen gemäße Ausrichtetheit der Meditation, also zB Richtung tieferer und tiefrer Ruhe oder auch größerer und größerer Entspanntheit, usw wurde im Zusammenhang der vorhergehenden Verse 16 und 17 bereits  eingegangen bzw verwiesen.

"als seiend auf der Brust eines als Leichnam vorgestellten  Śiva, der auf einem 15-fach verwinkelten Yantra liegt und, Mahakala verpflichtet seiend, tief versunken ist ins süße Liebesspiel mit Mahakala, " bezieht sich eben auch auf die Tatsache, daß jemand für den jener Bereich der Untstebrlichkeit, jenes unbegrenzte absolute Bewußtsein keine wirkliche Realität ist - sondern allenfalls noch "nur" ein theoretisches Konzept - für den sind auch Shiva sowas wie "vielleicht ja existent, vielleicht auch nicht existent und insofern wie tot". Verständlicherweis stützt sich die Ausübung von Meditation (siehe Abschnitt über Swami Shantanand Saraswati und seine Ausführungen zu Meditation) dabei zunächst mal ja erst nur auf jene gewisse "Mutmaßung", daß sowas Sinn machen könnte und dennoch davon ausgehend, daß man es ja nicht wirklich wisse und insofern istv es dann eben wie auf der Brust des als nicht-existent, tot (als "Leichnam") vorgestellten Shiva, der, wenn es ihn doch geben sollte vermutlich oder auch eventuell so typisch menschliche Züge hätte und doch gewiß über alle 2 Ohren in eine schönste aller Frauen verliebt wäre und sicherlich gerade mal wieder mit dem Liebesspiel mit ihr befaßt sei. Das Gebundensein, Verhaftetsein nicht-erleuchteter Mensch führt dann zu von Täuschungen überlagerten, begleiteten oder auch dominierten Vorstellungen in diesem Zusammenhang; insofern wäre die Beziehung Shivas zu Mahakala wie die eineseingezogenen einfachen Soldaten. Na klar "Zeitsoldaten"tten ja auch das Wörtchen "Zeit" gleich ganz am Anfang und bei der BW wurde oft gefragt: "Wehrpflichtig" oder "Zeit-Soldat", wobei der Begriff "Zeit-Soldat" wiederum das Wortspiel "Soldat der Zeit", "Soldat Kalis" nahelegt.

"der auf einem 15-fach verwinkelten Yantra liegt": Nunja, selbstverständlich wird Shiva höchst kompliziert vorgestellt - da er einem ja "fern", weil von einem selber irgendwie nicht wirklich gekannt erscheint und insofern evtl auch als seiend oder auch lebend in einer (für Menschen schier unvorstellbar komplizierten, komplexen und eigenartigen) 15-dimensionalen Welt.

"wird selber zum Überwinder des Gottes der Liebe.": Das Verhaftetsein in den Bereich der Liebe, wie es sich auch in Goethes Worten als  „Das ewige Weibliche zieht uns hinan" ausgedrückt findet“.( Mit diesen Worten endet Goethes Drama Faust II. Faust ist gerettet, seine Seele muss er nicht an Mephisto, den Teufel, abtreten. Doch was hat es mit dem Ewig Weiblichen auf sich? Darüber wird vielfach spekuliert. Ist die Kraft der Liebe gemeint? Oder die Kraft der Weiblichkeit, die ins Mystische, nicht ganz Nachvollziehbare reicht? Was meinen Sie? (heißt es bei: http://www.werhatdasgesagt.de/kategorie/literatur-zitate/johann-wolfgang-von-goethe-zitate/), gilt gemeinhin als besonders schwierig zu überwinden.(Filmisch wurde dieses Thema etwa dargestellt per: Und immer lockt das Weib – Wikipedia
https://de.wikipedia.org/wiki/Und_immer_lockt_das_Weib
und immer lockt das Weib (Alternativtitel … und ewig lockt das Weib, Originaltitel: Et Dieu… créa la femme) ist ein französischer Film von 1956 mit Brigitte Bardot ...
Deutscher Titel‎: ‎… und immer lockt das Weib
Originaltitel‎: ‎Et Dieu… créa la femme
.). Insofern wird in diesem Vers zum Ausdruck gebracht, daß das SELBST, jenes absolute Bewußtsein zu erlangen ist indem man auch die subtilste Form von Liebe hinter sich läßt (vgl Swami Shantanda Saraswati: Selbst das Reden von "Wertschätzung" ist Dualität. In tiefer Meditation betreiben wir nicht einmal Wertschätzung von Friede, Wahrheit, Glückseligkeit oder auch Bewußtsein; tatsächlich werden wir friedlich, wahrheitsliebend, glückselig und unseres SELBST bewußt. Man muß alle Ideen des Wertschätzens in Bezug auf das Mantra aufgeben. Das Mantra wird auf natürliche Weise in jener Einheit zu jener Ruhe  kommen in der es keine Aktivität und Unterteilheit gibt.) und wie es Swami Shantaand ebenfalls zum Ausdruck brachte (siehe zB Amerkungen des Übersetzters zu Vers 16), Gedankeninhalten mit der Entscheidung entgegen zu treten sei, daß man sich damit nach der Meditation befassen werde, weil man sonst sich im Widerspruch zur Meditation befände:>> Falls wir, in der Meditation, nachdem wir mit dem Mantralaut begonnen haben, anfangen nach irgendwas Ausschau zu halten, vielleicht einen Ton oder auch eine Substanz, haben wir aufgehört/sind dabei aufzuhören zu Meditieren, machen wir was im Widerspruch zur Meditation<<, sagte Swami Shantanand Saraswati, wie ebenfalls in den Anmerkungen des Übersetzters zu Vers 16 zitiert wurde. Sich in den Zustand des Turyia , des Samadhi zu begeben heißt auch die schönsten Theorien, die liebevollsten, zärtlichsten Gedanken und Vorstellungen hinter sich zu lassen, weil all das noch der Bereich der Dualität ist und nicht jenes absolute Bewußtsein, das SELBST. Damit sollte leicht verständlich sein, wieso man per richtiger Meditation auch zum "Überwinder des Gottes der Liebe" wird. Jener Zustand des Samadhi, jenes Turyia in dem das SELBST erlebt wird/gefunden wurde hat den Bereich der Gedanken, Liebe, des Geldes und all das, sozusagen,"überwunden".


VERSE 19   O DARK One, wondrous  and excelling in every way, becomes the accomplishment, of  those  worshippers who  living  in  this  world freely  make  offering to Thee in worship of the greatly satisfying flesh, together with hair and bone, of cats, camels, sheep, buffaloes, goats, and men.

Vers 19, Oh Dunkle, Du Beeindruckende sowie Schöne und dich in jeder Hinsicht sich Auszeichende sowie Hervortuende, würdest zum Ergebnis für jene, die - in dieser Welt lebend, in Freiheit Verehrung zollend dem großartigen Fleisch sowie den Haaren und Knochen von Katzen, Kamelen, Schafen, Büffeln, Ziegen und Menschen - Dir etwas Dich erfreuendes bzw wenigstens etwas, das von Dir nicht als total blödsinnig - täuschungsfreierweise -  gewußt wird entbieten.

Anmerkungen des Übersetzters ins Deutsche:

Dieser Vers wird zu meinem Enstetzen und allertiefstem Bedauern sowie Leidwesen fehlinterpretiert im völlig absurden Sinne von "Tieropfern" (siehe jene brutalen, absurden, unschönen, primitiven "Tierversuche") udgl. Jene die das so missverstehen, haben obigen vers letztlich in etwa wie folgt fehl-"übersetzt":
"Oh Dunkle, Du beeindruckende sowie schöne und dich in jeder Hinsicht sich auszeichende sowie hervortuende, wirst der Erfolg jener sein, die in dieser Welt leben,  aus eigenen Stücken, eigenem Antrieb,  Dir versuchen Opfer per des großartig zufriedenstellenden Fleisches zusammen mit Haaren und Knochen von Katzen, Schafen, Büffeln, Ziegen und Menschen zu bringen ."


Es wird so völlig absurd mißverstanden als ginge es in etwa um einen unmenschlichen, würdewidrigen, freiheitswidrigen "Wettkampf"  bei welchem es als Gewinn - dh hinterheriges "Besitzen "  für den "Sieger" eine wunderschönen Frau in gefesseltem Zustand als Geschenk zum "Gebrauch" gäbe.
Wie wird es zu verstehen sein, wenn man korrekt meditiert?
Nun, wenn man zB TM machte, so fängt man da ja, wie gelernt, mit dem mantra an; es findet jenes "Transzendieren" statt, man gelangt - wie es Swami Shantanand Saraswati gut verstehbar und hilfreich beschrieb - kurzzeitig zu jenem "Absoluten" Bewußtsein,  jenem "reinen Bewußtsein",  dh erreicht einemn momentanen Samadhi, erreicht kuzzeitig jenes "Turyia". Übt man TM (oder sagen wir ruhig jene Meditationspraxis welche Swami Shantananda Saraswati lehrte, der einerseits ebenso Schüler von Swami Brahmananda Saraswati war wie Mr. Mahesh, als auch - im Gegensatz zu Mr. Mahesh - sysematisch zum Guru ausgebildet wurde ) regelmäßig über einen - individuell durchaus verschiedenen - längeren Zeitraum regelmäßig morgens und abends jeweils so jene 1/2 Stunde lang aus, so wird man zunehmend vertraut mit jenem absoluten, reinen Bewußtsein und der Zustand des Samadhi hält länger an. In den Perioden jenes längeren Samadhi merkt man dann, daß man anfängt die Umwelt seltsam deutlich und klar wahrzunehmen udn das in einem Zustand von Zu-Ruhe-Gekommen-Seins, einem Zustand von Ausgeglichenheit, Entspanntheit und insofern  einem Zustand von "Freiheit", einem frei sein. "Frei seiend" findet einerseits jene verfeinerte Wahrnehmung des so seltsam klar wahrnehmens (Hören, Riechen also va, da man ja bequem sitzend und mit geschlossenen Augen meditiert) und andererseits versteht man das ja anfänglich nicht und es findet eine sehr subtile, feine, zarte gedankliche Befassung mit jener Frage statt, was das denn nun (wieder) sei. Irgendwann wird jene subtile Wahrnehmung und jene gedankliche Aktivität von der selben Subtilität sein; man merkt jene subtile gedankliche Befassung und fängt, da man ja zum meditieren dasitzt, an sich davon zurückzuziehen, dh auch jenseits dieser subtile Aktivität zu gelangen, dh "das auch zur Ruhe zu bringen", wobei die Aktivität des "Das auch zur Ruhe birngen wollens" seinseist wieder eine Aktivität, ein aktives Wollen, beabsichtigen und insofern wiederum ein "Tun", eine "Tätigkeit" darstellt, sodaß man auch davon Abstand zu nehmen beginnt in einem Zustand überwältigender, transzendenter, umfassender Ruhe, jenem "Brahman". Im Rahmen jener subtilen Sinnestätigkeit sowie gedanklicher Tätigkeit in jenem Zustand  andauernden Samadhis, findet eben auch die ganz natürliche Befassung mit zB miaenden katzen, rufenden Kamelen, blöckenden Schafen, meckernden Ziegen und irgendwelchen redenden Menschen statt. (Man denke sich zB, daß man auf einem Gnadenhof für Tiere, also sowas wie Aiderbichl, nen Zeit verbingt und dort auf einer ruhigen Sitzbank zB im Schatten eines Baumes seine zB Abendmeditation verbringt; natürlicherweise, in natürlicher Umgebung sind da eben immer irgendwelche Tiere oder auch Menschen, die Laute oder auch Gerüche von sich geben. Dieser Text stammt nunmal aus einer Zeit wo das die normale Umgebung eines Menschen war); auch Gerüche von irgendwelchen vorbeiziehenden oder an einem mal kurz riechenden Schafen, Ziegen usw kommen auf einen da uU zB zu. Man kann  noch so bemüht sein, möglichst nicht gestört zu werden bei seiner Medtation, aber es kann einem auch in einer Höhle sitzend und meditierend passieren, daß einige Mäuse oder auch Katzen in die Höhle zu Besuch kommen  und mit zaghaftem, verständisvollen Quieken oder auch Miauen versuchen  zu begreifen. was der/die/zwi Meditierende da tut und ob er/sie/dö vielleicht ja doch ansprechbar ist oder aber auch sich untereinander was zuflüstern und die meditierende Person wegen deren Ruheposition gar nicht wahrnehmen bzw registrieren. (So habe ich zB erlebt, als ich mal  unweit der romanischen Kirche"Dompeter" im Elsaß  - so ca 25 km entfernt von Straßbourg - mit einer Begleiterin in einem Waldstück meditierte, daß beim Beenden der Meditation sichtbarerweise eine Maus direkt neben meinen Füßen sah und ich das Rascheln des Laubes, verursacht von jener Maus, auch schon während der Meditation  wahrgenommen hatte. Ich erlebte es zB auch mal als ich nach Ende der Arbeitszeit  - im Freien an einem Eingang - noch im Freien meditierte - es war Winterzeit, kein Mensch war den ganzen Tag gekommen, es hatte den ganzen Tag leicht geschneit und es lagen bereits ca 10cm Schnee auf mir - , daß der Platzwart der Sportanlage von nebenan mit seinem Pudel noch einen Rundgang machte, mich sah und mir auf die Schulter klopfte "Hallo, lebst Du noch?" (.... Das war dann von jenem Platzwart wohl eher auch etwas scherzhaft gemeint und es störte mich ja auch gar nicht, es war ja nett...). Nun wie weit führt jene "Subtiler werdende Wahrnehmung"? Irgendwann merkt man, daß das jetzt auch zur Ruhe gekommen ist und eine umfassende Ruhe und Entspanntheit da ist. Dieser Zustand stellt sich dann eben immer wieder mal beim Meditieren ein und wird normaler und normaler und eines Tages kapiert man dann endlich die Natur dieser Erfahrung: Mensch, das Tier, das da miaut oder grunzt, muht oder auch wiehert, blökt oder auch meckert, wird im Lichte jenes reinen  Bewußtseins wahrgenommen, weil es auch dieses reine Bewußtsein ist und genauso so viel Lebewesen ist wie man selber und man selber nicht  mehr und nicht weniger Lebewesen ist als wie jenes Tier. Man kann nicht mehr anders als jenes Tier, jene Pflanze als ein Lebewesen wie man selber zu empfinden, zu begreifen, zu verstehen, zu tolerieren und va zu mögen, wertzuschätzen, zu ehren, wertzuschätzen und einfach unendlich, nie endend, transzendent gern zu haben. (....Man fängt dann an jene Impulse von Freundschaft, Liebe, Vorsichtigkeit, Achtsamkeit auch in den Tieren und Pflanzen wahrzunehmen; dasselbe gilt für andere Menschen. Dabei bleibt aber Gefahr eine Gefahr, Schmerz bleibt Schmerz und man wird nicht blöd und läßt sich nicht einfach von Tieren fressen, von Menschen für dumm  verkaufen odgl, dh die "Kirche bleibt im Dorf". Man sieht jenen Impuls von Freundschaft zB auch in Tigern und anderen Geschöpfen, daß auch jene Freundschaft, Wertschätzung kennen und schätzen. Man sieht eben auch, daß aber auch, daß auch ein Tiger sich nicht für dumm verkaufen lassen will und Möglichkeit der Selbstverteidigung und Wehrhaftigkeit hat...).

Also genauer noch: Da ist zB jene Wahrnehmung eines Lautes, die so eigenartig klar ist und die Erkenntnis ist, daß diese Klarheit daher rührt, daß jener laut aus jener selbe Klarheit besteht, die da in jemnem andauernden Zustand von Entspanntheit, jenem länger andauernden Samadhi festgestellt wurde Nun ist man sicher, daß jenes, das man da als Folge des "Transzendierens" da von sich selber ausgehend mittels jenes Mantras da erreichte, erlangte, wirklich dasselbe war, als das was auch in jenem zB Ton war. Dann ist man sich sicher, daß jenes eben nicht getrennt einerseits im Mantra in sich und andererseits außerhalb im Ton existent war, sondern daß es ein durchdringendes reines Bewußtsein war/ist, ein und dasselbe etwas.
Es ist diese Art von Erfahrung, in der das Fleisch als "großartig befriedigend" wahrgenommen wird, was heißt, daß eben ein ier an seinem Fleisch, seinen Muskel, seinen Knochen und Haaren genauso hängt wie man selber auch und daß man als Mensch schlicht und einfach keinerlei Recht hat den Tieren danach zu trachten. Lebt man diese Realität, die für Kali mindestens ebenso selbstverständlich ist, ist da etwas, was einen mit den GöttInnen verbindet und was eine Kommunikatiosnbasis insofern darstellen kann. Nachdem also ab da - infolge der regelmäßigen Meditation, jenem "Opfer" von ca 2-mal je 1/2 Stunde systematische Meditationspraxis-Ausübung morgens und Abends - für die eventuell ja existente Schar der GöttInnen eine "Kommunikationsplattform" errichtet wurde und den etwaig existenten GöttInnen also insofern von einem angeboten, dargereicht, entboten wird, hat man somit auch Göttin Kali, wenn es sie numal geben sollte (es sei ihr von Herzen gegönnt) ein Opfer gebracht und zwar eine Art von Opfer, die einem Gott angemessen sein kann, gefallen kann. (Jesus soll mal gesagt haben: "Gott sind jene Tieropfer ein Greuel" und in jenem Punkte hätte jener Mensch Jesus voll und ganz  Recht gehabt.). Jene Befassung mit jener subtilen Wahrnehmung ist ja in gewisser Weise auch eine "Verehrung" für das was "dahintersteckt", jener Allumfassendheit jenes absoluten Bewußtsein, daß es auch in den Tieren ist, auch in den Tieren als ein Bewußtseinsphänomen von ihnen, erkennbarer/erlangbarerweise ist und das von ihnen auch wertgeschätzt wird und werden kann.  (Ich hatte mal für 14 Tage einen Hund, einen Cocker-Spaniel ("vom" früheren Sektenbeauftragten der r.-kath. Kirche, Hans Löffelmann), in Pflege, als Gast in meinem Zimmer. Wenn ich zu lange am Computer gearbeitet hatte, merkte er anscheinend, daß ich anfing übel zu riechen -vermutlich  infolge des Stresses den ich mir antat - und er legte die Pfoten auf die Tastatur; nun sagte ich zu Ihm: "Ich müßt's noch rasch abspeichern" und dann alles ausschalten, was ich dann auch "durfte" und tat. Danach aber legte er seine Pfoten so bestimmt und "wild entschlossen" auf die Tastatur, daß kein "Weiter sich-Stressen" ("Weiterarbeiten") "gut miteinander auskommend wollend" mehr möglich gewesen war, bzw er drückte sich entsprechend deutlich, aber durchaus vornehm nett bleibend, aus.
Wenn ich dann, nach einem Spaziergang mit Ihm erst mal nen paar Yoga-Asanas machte, sah Er mir erst nen paar mal zu und beschloß dann, mitzumachen; er machte Drehsitz, Diamantsitz, Hin&herrollen, usw eben auf seine Weise und aber eben genau unterscheidlich und erkennbar als das; manches machte er gleich wesentlich besser wie ich und mit viel mehr lockerer , natürlicher Entspanntheit dabei, so wie zB den "Drehsitz". Dh, er hatte eine gewissen Sinn für Yoga. Vielleicht nahm er ja auch "geruchsweise" wahr, daß es mir gut tat. Wunderbar, wirklich wunderbar. Ich pflegte auf Spaziergängen Schnecken vom Weg zu tragen, damit sie nicht zertrampelt werden. Eines Tages, ich versorgte gerade die kleine Herde 4-Hornschafe - und machte eine kurze Pause und nen kleine Spaziergang mit ihm- , merkte ich, daß er nach einer Schnecke auf dem Weg "schnappte", ich sah genau hin und was tat er?  Er setze sie, selbstverständlich fürsoglicherweise und unverletzt nebenan ins Gras, so wie ich es zu tun pflegte. Einmal ruhte ich mich neben Ihm aus. Da machte er mich auf sich aufmerksam. Er hatte erst in seinen Wassereimer (per seiner Schnauze) "gegriffen" und legte mir dann einen quicklebendigen, unversehrten Siesel-Hüpfer (größerer Grashüpfer) auf die Hand und sah mir genau zu, was ich damit machen werde und registrierte genau, daß ich ihn in ein unversehrtes Stück Grasland brachte und "fliegen/hüpfen" ließ.)

Diese "Verehrung" (, die da dann eben im Ramen der Meditationssitzungen stattfindet, wenn da der Zustand des Samadhi erst mal länger andauert und), die dann zum Errichtethaben jener "Plattform", "Kommunikationsplattform" führt, war insofern eben auch ein "Dir, etwas  Dich erfreuendes bzw wenigstens etwas, das von Dir nicht als total blödsinnig - täuschungsfreierweise -  gewußt wird entbieten" (und insofern Gott, evtl ja auch Göttin Kali - falls es sie nunmal als indivduelles, unsterbliches, erleuchtetes Lebewesen geben sollte - "Entbieten", "Anbietendes"; es ist ein frei bleibendes Angebot an sie, eine ihnen zur verfügung stehende Kommunikationsplattform und, mal so betrachtet, ein Geschenk an jene ).

Erst jener Zustand jeneseits von Gestreßtheit, jener Zustand von Entspannheit, jenes Reine Bewußtsein, momentaner Samadhi, was auch als zumindest momentane richtige Freiheit, zumindest mal momentanes so richtiges frei sein empfunden beschreibbar ist. Dann jene subtile Aktivität die sich so eben dann ergibt, schließlich jene Erkennnis des "ich bin das, Du bist das" und das Verständnis der Natur jener "seltsam klaren Wahrnehmungen" und dann (und wohl erst dann) kann man jenen Satz von "Opfern dir in Verehrung jenes großartigen..." verstehen; dann kommt man auch nicht mehr auf jene absurden, völlig abwegigen, blödsinnigen, allenfalls nachteiligen Gedanken, Ideen alà "Tieropfer bringen", weil es der erlangten direkten Wahrnehmung nunmal so klar widerspräche, daß man es unterläßt. Dann hat man wenigstens jene "Täuschungsproblematik" insofern hinter sich gelassen.

 



VERSE 20   O MOTHER, he who, being a controller of his passions, eats haviyānna, and, being proficient in meditation on Thy feet, rightly recites Thy  mantra  a hundred  thousand times by day, and he who afterwards naked at night, when united with his, rightly recites Thy great mantra another such hundred thousand times,   becomes on earth like unto the Destroyer of Smara. 

Vers 20   Oh Mutter, jemand, der Herr über seine Leidenschaften ist, der nicht mehr von seine Leidenschaften beherrscht wird, Haviyānna ißt richtiges Meditieren gewöhnt ist, fähig ist Meditation zu deinen Füßen auszuüben, jene Meditation welche deine Wege, Art&Weise, Weisheit berücksichtigt/respektiert, korrekt dein Mantra einige hundertausendmal mal pro Tag rezitiert und wenn so jemand desnachts dann, wenn er nackt ist, vereinigt mit  seiner  Śakti weitere hundertausend mal dein großartiges Mantrra korrekt rezitiert, so jemand wird auf Erden dem Überwinder von Smara, einem Überwinder von Sehnsucht, Erinnungeren und auch Gelüsten gleich, sojemand wird zu Jemandem, der befreit ist von der Herrschaft der Sehnsüchte, Gedächtnisproblemen und Gelüste..


Anmerkung des Übersetzers ins Deutsche:
Nun wie sollte jemand 100 000-mal an einem Tag ein Mantra rezitieren und in der Nacht es abermals können? Wenn jemand korrekte Meditation praktiziert (siehe zB die Ausführung von Swami Shantananda Saraswati betreffs Meditation, welche ich in Übersetzung in dieser homepage unter Swami Shantananda Saraswati angefügt habe) und zu jenem Bereich völliger Ruhe jenseits von Denken, auch jenseits all der subtileren Formen des Denkens wie Wünschen, Sehnen, Verlangen angelangt ist und infolge jener damit einhergehenden Transformation aus so einem momentanen Samdahi allmählich  ein Nitya-Samadhi (Allzeit-Samadhi, ewiger Samadhi) wurde, "in" sojemand ist stets das Mantra in Form jener Ruhe, jenes Selbst, jenes Atman gegenwärtig, der Sinn&Zweck des Mantras und insofern das eigentliche Wesen des Mantras wird von sojemanden also stets gelebt und es begleitet sojemanden jener nitya-Samadhi, jenes absolute Bewußtsein, jenes Wesen des Mantras allezeit, bei allen Handlungen, bei jedem Atemzug und Herzschlag; insofern wird es sozusagen 100 000-mal (oder mehr) pro Tag "wiederholt". Dieser Zustand des Samadhi übersteigt, transzendiert bereits das Denken, Reden, Vorstellen, Träumen,  Fantasieren, Wollen, Wünschen, Sehnen und kann nicht gedacht, nicht geträumt, nicht fanatsiert odgl werden; könnte man es erträumen, bedenken, ausrechnen odgl bedürfte es schließlich keiner Meditation mehr. Wachen, Träumen, Schlafen sind 3 Bewußtseinszustände, Turyia ist ein vierter Zustand des Bewußtseins, der verschieden ist von Wachen, Träumen und Schlafen, weil es sonst ja nur eine spezielle Variante von einem der 3 Anderen wäre. (siehe Shiva-Sutren).

Zweifelsohne wird jene "Anwesenheit des Wesens des Mantras" noch um so klarer sein, wenn "Ich bin das, Du bist das" auf der Ebene der Erkenntnis, also nach der wahrheitsgemäßen Erkenntnis dieser Realität/dieser Wahrheit gelebt wird. Woimmer der Strahl der Aufmerksamkeit fällt, dort ist natürlicherweise, ohne Anstrengung (ohne es so Haben zu wollen) jenes reine Bewußtsein und die Wahrnehmung und insofern auch immer &immer wieder Akzeptanz desselben.

Dieser Zustand wird in diesem Vers sehr deutlich beschrieben.

Überall in dieser Welt ist Zeitlichkeit und wenn jemand Nitya-Samadhi lebt, so ist auch überall Zeitlosigkeit und "Die Göttin der Zeit" wird als  "unproblematisch", ja als erfreulich, als wunderschön ganz natürlicherweise anerkannt und empfunden. Nicht mehr die Zeitlichkeit mit all den Sorgen, die sie mit sich bringt, dominiert das Leben; nein, "indem das Gemüt durch das SELBST zur Ruhe gebracht wurde findet man das Glück im Verweilen" (König Janaka, Yogavasishta). Die Wellen und deren Kommen und Gehen sind kein Problem angesichts  der Fülle des Ozeans, der nie leer wird; jene Wellen, jene Phänomene der Zeitlichkeit haben Schönheit und sind Phänomene von Freude, Fülle, Unendlichkeit, Reichtum.


Donovan besingt in einem Song seiner CD "Donovan Suktas" sehr einfühlsam und schön all die Gefühle, wenn jemand räumlich getrennt ist von seinem/seiner/seinö geliebten Partner/~in/Partzwi, also sowas wie "weit weg seiend, träume ich von Dir, sehn mich nach Dir,..." und Er kommt zum Fazit: "I'll give it all up to be with you", dh "Ich gebe all das auf, um mit Dir zusammen zu sein" und drückt damit aus: Was sind schon all diese Gefühle im Vergleich eines Zusammenseins mit Dir?


( Anmerkung des Übersetzters is Deutsche: bzgl.: "haviyānna" siehe zB: Prabhupada - Krishna-Die Quelle Aller Freude 1 - [PDF Document]
https://vdocuments.mx › ... › Prabhupada - Krishna-Die Quelle Aller Freude 1
Zuerst aßen sie haviyānna, eine Speise, die zubereitet wird, indem man Mung-Dahl zusammen mit Reis in Wasser kocht und dabei auf jegliches Gewürz und ..Prabhupada - Krishna-Die Quelle Aller Freude 1 - [PDF Document]; https://vdocuments.mx/download/prabhupada-krishna-die-quelle-aller-freude-1

es heißt dort auf Seite 94: >> Zuerst aßen sie haviyānna, eine
Speise, die zubereitet wird, indem man Mung-Dahl
zusammen mit Reis in Wasser kocht und dabei auf
jegliches Gewürz und auf Turmerik verzichtet. Die Anweisungen der Veden empfehlen dieses Essen zur
Läuterung des Körpers, bevor man eine rituelle
Zeremonie durchführt.  <<

bzgl. des Begriffs/Wortes "Smara" siehe zB: https://wiki.yoga-vidya.de/Smara#Quelle
1. Smara (Sanskrit: स्मर smara m.) Erinnerung, Gedächtnis; Sehnsucht, Liebe; der Liebesgott; ein Erklärer des Veda; das siebte astrologische Haus.
2. Smara (Sanskrit: स्मार smāra adj. u. m.) den Liebesgott (1.) anbelangend, diesem gehörig; Erinnerung (an); Sehnsucht.



VERSE 21   O MOTHER, this Hymn of Thine is the source from whence originates Thy  mantra. It sings of Thy real self, and contains injunctions for the worship of Thy two lotus Feet. He who reads it at  midnight or at time of worship even his random talk becomes the nectar juice of poesy. 


Vers 21  Oh Mutter, diese deine Hymne ist die Quelle aus der Dein Mantra hervorkommt, diese Hymne ist der Ursprung deines Mantras. Sie besingt dein wahres, wirkliches SELBST und sie enthält Verfügungen, offizielle Gesetzmäßigkeiten mit dem Ziel Mißbräuchlichkeiten, Mißverständnisse zu verhindern und zwar betreffs der Verehrung deiner zwei Lotusfüße, betreffs dessen was eine wahre Empfindung, ein wahres starkes Gefühl  bzgl deiner zwei Lotusfüße ist und was nicht, bzgl der Hochachtung für deine zwei Lotusfüße. Wer sie um Mitternacht oder auch zu einem Zeitpunkt einer Empfindung von Hochachtung oder auch einer Andacht, einer Verehrung liest, so wird selbst der Alltagssprachgebrauch zu einem nektarartigem reinen Saft der Poesie, so wird selbst die Alltgagsprache zu Nektar und leicht bekömmlich, aufnehmbar wie bester Fruchtsaft und voller Poesie aber auch wie Nektar und Poesie für Dich, in deinen Ohren.

Anmerkungen des Übersetzers ins Deutsche:
>> Sie besingt dein wahres, wirkliches SELBST und sie enthält Verfügungen,  <<. Üblicherweise wird das englische Wort  "injunction" verwendet, um gesetzliche Regelung, bei denen es um die Verhinderung von etwas ankommt, zu bezeichnen. (Siehe zB Cambridge Online- Wörterbuch https://dictionary.cambridge.org/de/worterbuch/englisch/injunction ). zum Begriff "wahres, wirkliches SELBST" von Kali sei auf die Vedanta-Sutren von Badarayana (= Vyasa) - siehe zB die Übersetzung von Prof. Paul Deussen - ebenso verwiesen wie auf das Yogavasishta. Auch der Anhang betreffs der 6 System indischer Philosophie zur "Übersetzung" und Kommentierung der ersten 6 Kapitel der Bhagavad Gita durch Mr Mahesh,scheint mir erwähnenswert, obgleich ich eine jener zusammenfassenden Darstellungen nahezu wörtlich bei Shankara fand; dies mag als Hinweis, als Einstiegshilfe und bisweilen auch als "Richtschnur" zu jener Thematik bisweilen durchaus hilfreich sein. Auch in meinen Hinweisen, Anmerkungen zum vorherigen Vers, ging ich kurz darauf ein.

In jenem Teil meiner homepage betreffs "Gut-Möglich" gehe ich darauf ein, daß ein Mensch aufgrund seiner Art von Körper versehentlich irgendwelche Tiefsee-Lebewesen gewiß nicht versehentlich verletzen, geschweige denn töten kann. Albatrosse die ca 10-11 Monate im Jahr in der Luft verbringen und nur auf abgelegenen Inseln, die menschenleer waren, kann man als Mensch ebenso versehentlich kaum verletzen, geschweige denn töten. Für Adler, die auf hohen Bäumen brüten, in abgelegenen Gegenden zuhause sind, gilt es analog. Selbst eine Fliege kann man als Mensch bisweilen oder auch meist nur schwerlich fangen, selbst wenn man sie doch "nur" aus einem Zimmer, in das sie sich  verirrt hatte, unverletzt befreien möchte und umso unwahrscheinlicher ist es, daß man sie versehentlich töten kann, da ein Mensch selbst bei Rennen mit menschenmöglicher Höchstgeschwindigkeit, eine Fliege wohl eher nicht "der-rennen" kann.
Kleinere Tiere wie Mäuse, Kaninchen, Murmeltiere usw pflegen zudem sehr wachsam zu sein, sodaß auch sie vor einem "normalen" Menschen praktisch sicher sind.

Nun ist es aber leider so, daß man als Mensch versehentlich eine Ameise oder auch insbesondere kleinere Schnecke zertreten kann.
Natur- und tierliebe Menschen bedauern das. (Auch der Sonnengesang des "Hl." Franz von Asissi, scheint  das mit zum Ausdruck zu bringen, auch wenn sich weite Teile der Kirche anscheinend wenig darum zu schreren schienen und scheinen.)
Es ist gut vorstellbar, daß ein gewissenhafter Yogi sich bemüht solche
"Versehentlichkeiten" zu minimieren. So gibt es in Indien  bekanntlich auch jene religiös-weltanschauliche Gruppierung der Jainas, die mit einem Besen, den Boden vor sich kehren, um solches Töten, verletzen zu reduzieren bzw in der Hoffnung es vereiteln zu können.
Wieso sollte also ein Gott, eine Göttin nicht auch solche Empfindungen haben und sich daher auf einen extrem subtilen Körper beschränken, der eben solcherart ist, daß damit eine versehentliches Töten oder auch verletzen unmöglich ist?
 Der "Apostel" Paulus beschreibt in der Apostelgeschichte an einer Stelle, daß es Wesen gäbe mit einem Körper aus Licht (genau Zitatangabe folgt noch), Nunja mit so einem Körper kann man nunmal eine Ameise versehentlich nicht zertreten.
Insofern scheint es dann auch angemessen die Füße  Gottes, eines Gottes, einer Göttin, eines Göttzwis bewundern, verehrend, hochachtend zu erwähnen und dafür sogar einen eigenen, poetischen, dennoch möglichst päßlichen Ausdruck erfunden zu haben, zu gebrauchen und sie als  "Lotusfüße" zu bezeichnen.
Eine Verehrung, Bewunderung, sachlich Anerkennung für jene natürliche Situation des versehntlich weder Töten- noch Verletzenkönnens, würde insofern auch eine subtile Tätigkeit in Hinblick auf das sein was subtiler als das Subtilste, kleiner als das Kleinste ist, nämlich jenes absolute, reine Bewußtsein. Verständlicherweise kann also die vorliegende  Hmyne, bei entsprechendem Verständnis, Menschen zu einem päßlicheren Umgang mit der Natur und ihrer körperlichen Situation anregen. So eine Hmyne kann einen Mensch inspirieren oder auch darin bestärken wenigstens nicht schlechter sein und leben zu wollen, als er/sie/zwi versehentlich nunmal gar nicht würde können.
Sowas mag sich dann auch in der Sprache ausdrücken, da es nunmal auch was mit Alltag zu tun hat; mit seinem Verständnis wird so jemand natürlicherweise auch in zwanglosen Alltags-Gesprächen sein Verständnis zum Ausdruck bringen, das im Vergleich mit den Grobheiten, welche das Ausdrücken und Verfechten einer schlechteren Lebensweise nunmal mit sich bringt, wie Poesie klingt und ist.

Viele Menschen reden von Kundalini-Erfahrung & co und erliegen aber dennoch lediglich einer "Täuschung". Bekanntlicherweise ist das Problem der Täuschung auch ein wichtiges Thema im Zusammenhang mit Yoga, Tantra, Religionen, religiösen Gruppierungen aber auch weltanschaulichen Gruppierungen, ja selbst Wissenschaften. (Das allbekannte Problem der Justizirrtümer, fehlerhaft gemachten Gesetzen polizeilichen Ermittlungsfehler udgl gehört selbstverständlich auch  dazu.) Etliche "Naturgesetze", die von Physikern oder auch Chemikern dereinst mal verkündet worden waren, mußten ergänzt, korrigiert oder auch ganz gestrichen werden. Das Phänomen der Täuschung ist ein sehr ernst nehmendes Thema und auch in dieser Hymne, dem Kali-Karpūrādi Stotra, wird es mehrfach angesprochen.

Insofern bietet es sich eben auch an, gewisse eigene, für spirituell und bedeutsam  gehaltene, Erfahrungen mit wahren Texten dazu aus der Vergangenheit, verfaßt von Meistern auf jenem Gebiet/jenen Gebieten zu vergleichen. Insofern wird das Kali-Karpūrādi Stotra dann mit Hochachtung, gewißlich auch viel Vorschußlorbeeren - da man ja selber die Wahrheit noch gar nicht kennt und also selber vernünftigerweise "nur" strategisch "unterwegs" ist, einer brauchbaren bis möglichst guten Strategie gemäß sich mit der Thematik befaßt - dann auch um Mitternacht oder auch zu irgendwelchen Zeiten "gelesen", weil als Vergleich oder auch zu einem möglichen wahr sein sollenden Verständnis  "herangezogen" und aber, im Sinne der enhatltenen "Verfügungen" (conjunctions), nicht als Anleitung und Genehmigung für Taten benutzt, die schlechteres beinhalten als man versehentlich als Mensch -  im Sinne des Gut-Möglichen - nunmal würde können. Insofern wird dieser Hmyne "Verehrung" entgegen gebracht, sie wird in Ehren gehalten, ihr wird die gebührende Achtung entgegen gebracht und  man wird (siehe enthaltene Verfügungen,"conjunctions") auch aufgefordert, ihr dieses gebührende Maß an  Achtung entgegen zu bringen. Wer das nicht will, liest nicht das Kali-Karpūrādi Stotra, sondern seine eigenen Erfindungen, abstrusen bis abartigen Fantasieprodukte und wird in seiner Welt aus Täuschung/~en gefangen bleiben.

Jemand erzählte mir mal folgende Geschichte: Er arbeitete an einer Kasse und ein ziemlich regelmäßiger Kunde  fiel ihr/ihm/zwi aufgrund der Schönheit seiner Sprache und Sprechweise auf. Eines Tages war jene Person im Theater ("Kammerspiele" in München oder auch "Residenztheater" in München) und sie staunte nicht schlecht, als jener "Kunde" mit der aufallend schönen  Sprache und Sprechweise einer der Schauspieler auf der Bühne war. Später stellte sie fest, daß es auch nicht irgend ein unbedeutender Schauspieler, sondern ein in ganz Deutschland hochgeschätzer Schauspieler war.
So kann eben die Befassung mit Literatur udgl auch einen Einfluß auf die Sprachgewohnheiten eines Menschen haben und selbst Alltagssprache kann jene Schönheit von echter Literatur&Poesie lebendig sein lassen.
Also kann es nunmal sowas geben, wie in diesem Vers am Ende zum Ausdruck gebracht wird.



VERSE 22   NUMBERS of women with large eyes, like those of the antelope, impatient for his love, ever follow him. Even the King becomes subject to his control. He becomes like unto Kuvera himself.   An enemy fears him as if he were a prison.   Living in continuous  bliss the devotee is liberated when yet living, and is never again reborn.

Vers 22    Mehr oder weniger Frauen, aber keinesfalls eine anonyme Masse Frauen mit großen Augen wie jener der Antilopen, sich teils ungeduldig teils zappelig oder auch überdreht sehnend, verlangend nach seiner Liebe, seine Liebe fordernd folgen Ihm für immer bzw fühlen sich von Ihm angezogen. Sogar der/ein König wird zu Jemandem auf den er Einfluß hat, der ihm ergeben ist und ihn nicht beherrscht. Er wird sojemand wie bis hin zu Kuvera selber. Ein Feind fürchtet ihn als wäre er ein Gefängnis. In fortwährender Glückseligkeit lebend, verankert in Glückseligkeit ist ein (in Dich)  Ergebener/Ergebene/Ergebenö befreit, frei obschon noch lebend und er/sie/zwi wird nicht mehr wiedergeboren.

Anmerkungen des Übersetzters ins Deutsche:

Betreffs  >> Mehr oder weniger Frauen mit großen Augen wie jener der Antilopen, sich ungeduldig sehnend, verlangend nach Liebe <<, sei erwähnt:

Nunja, Mr. Mahesh sagte mal auf einem der Kurse, die ich zwischen 1971 und 1976 besuchte - und bei welchen er, meistens auch, zumindest für eine  Weile, persönlich  anwesend war, -:

"Wenn ihr mich weiter bis spät in die Nacht hinein - und bisweilen wurde es ja auch 4Uhr morgens - mit euren Fragen und Problemen belästigt, werdet ihr mich nicht lange haben".

Er fühlte sich also ziemlich vereinnahmt und mußte sich gewisse AnhängerInnen vom Leib halten. Er sagte bisweilen, daß man dies und jenes nicht tun solle (zB Minderjährigen ohne schriftliches Ok der Erziehungsberechtigten jene TM-Meditationsmethode beibringen) und gewisse TM-LehererInnen meinten aber offenbar genau das tun zu sollen, zu müssen oder auch "d'raufsetzen zu sollen, weil Mr. Mahesh sich nur nicht traue odgl".

Also, sich angezogen fühlen von so Jemandem, eine gewisse Sympathie oder auch eine Art von Wertschätzung für so Jemanden zu empfinden ist das Eine; so jemanden "besitzen" zu wollen, ihn zum Objekt der eigenen Begierde bzw von Begierde verfälschten Vorstellungen, "Idealen", "Wichtigkeiten" machen zu wollen oder auch meinen zu sollen, ist ganz etwas Anderes.

Was wäre das denn für ein Zustand von "Befreitsein", wenn jemand der mit Homosexualität noch nie was zu tun hatte wollen, dann plötzlich anfangen sollte müssen homosexuelles belästigtwerden "Willkommen" zu heißen, nett zu finden, erdulden zu können sich zu ver-meinen, erdulden zu müssen sich auferlegen zu müssen sich geistig zu ver-irren?  Sojemand wäre doch immer noch Gefangener von Täuschungen, Illusionen, Missverständnissen, Fantastereien. Auch ein homosexuell veranlagter  Mensch kann sich anständig, jenseits seiner homosexuellen Neigungen benehmen.

Andererseits könnte sojemand der "Befreitsein" erlangt hat, vorher einem Angezogenwerden von mehr oder wneiger Mädchen/Frauen nicht abgeneigt gewesen sein und wieso sollte es sojemanden dann hinterher groß stören? Wenn sojemand doch nicht mehr gebunden ist an so ein "Nicht-Abgeneigtsein", wieso sollte es so jemandem, hinterher plötzlich Probleme bereiten? Aber wenn das "Befreitsein"-Erlangen damit einherginge, daß sojemand dann jenem Nicht-Abgeneigtsein anfinge "extensiv zu huldigen", jenes Sich-Angezogenfühlen von gewissen Mädchen&Frauen "endlich ausnutzen" zu können sich erdreistetete, so würde es Ihm früher oder auch später ja doch nur Probleme bereiten und wie könnte so jemand dann "Befreiung" erlangt gehabt haben? War sojemand vorher nicht abgeneigt, so wird sojemand nach Erlangung der "Befreitheit" gewiß kein Problem damit haben, jene Situationen nicht auszunutzen, nicht Missbrauch zu treiben und jene Mädchen und Frauen "nun" nicht wie "unpersönliche Maschinen zur Befriedigung seiner Begierden" zu "be-nutzen". Im Englischen hieß es "NUMBERS of women" und dieses "NUMBERS" heißt ja doch wohl nichts anders, als daß man eben nicht voller Begierde ist, nicht guru-lich tätig zu sein vortäuschend auftritt und doch nur auf der Suche nach neuen Opfern zur Befriedigung der eigenen unwissenden Begierden ist, sondern daß man ihnen fair, unparteiisch, objektiv, der Wahrheit und dem Wissen über das Erlangen wahren Befreitseins gerecht werden wollend (also so in gewisser Weise wie wenn man eben "Mathematik" "macht") gegenüber ist und bleibt.
Mag bei jenen Begierde, Liebe und Sehnsuchgt nach Befreiung-Erlangen "vermischt" sein, mögne sie es nicht richtig auseinander halten können und bisweilen sich nicht ganz päßlich benehmen, bisweilen auf "dumme Gedanken" kommen, nur ein "Befreiter" wird eben Liebe, Begierde,Sehnsucht nach Befreitsein sehr wohl auseinander halten können, dumme Gedanken von klügeren und klugen unterscheiden können und auch tolerierbares von untolierierbarem Benehmen unterscheiden können.(....Im Yogavasishta ist häufig vom "unterscheidenen Denkvermögen" die Rede....) Würde denn nicht so eine zB Frau, die so nen "Angeblicher Befreiter" (wie jene brutalen, abartigen Psuedo-Gurus, die Anhängerinnen sexuelle missbrauch(t)en, nötig(t)en usw) missbraucht(e), sexuell nötig(t)e - oder auch finanzielle missbrauchte odgl - nicht auch irgendwann zu einer "Befreiten" werden? Was würde sie dann, wenn das mit dem "Befreitsein" so wäre wie jener Missbrauchs-Pseudo-Guru sich unwissenderweise, keinesfalls zu Guru-sein geeigneter, es sich anmaßte miss-zu-verstehen, dann mit jenem Missbrauchs-Guru hinterher - gemäß dessen was Er selber ihr an ihr selbst (leider bis leiderst) vorexerziert hatte -   so alles mit Ihm dann erst "machen dürfen" oder auch "sollen"? (Manche jener Missbrauchsgurus meinen ja auch noch, daß ihre Opfer das gewollt hätten und sie "somit" es hätten "sollen"?).

Analoges gilt auch für jene "Gurus" mit Bezeichnung "Psychologe" oder etwa gar "Psychiater": Erst fuhren sie rücksichtlos Trittbrett bei den grausamen Tierversuchen (jener "modernen" Form der Tieropfer) - oder beteiligten sich sogar auch noch selber daran - (In der Psychologie werden in jenem Teil mit der Bezeichnung "Behaviourismus" ebenfalls "Tierversuche" veranstaltet), dann machen sie - betreffs "Psychiatrie" noch ein Bischen auf  Traumdeuterei gemäß Sigmund Freud udgl, "Neurologie", "Facharzt für Psychiatrie" und sodann erdreisten sie sich der Welt erklären zu wollen - und sogar zu sollen bzw etwa sogar im Staatsauftrag per Ausübung von Staatsgewalt zu "müssen" und "auch deshalb zu dürfen" -, was ein "normaler Mensch" sei, daß Kundalini "Geistesgestörtheit" sei usw. In den "Lehren" ad Meditation aus den Reihen der Medizinerschaft - siehe etwa  jenes ca 700-seitige Buch von Knaurs zum Thema Medizin - kann man dann ua Anweisungen zum Gebrauch und zur Auswahl von Mantras finden, aber ebenso wie bei Mr. Mahesh findet sich beispielsweise nirgends ein Hinweis darauf, daß so eine Meditation, wenn sie den Namen zu Recht trägt - Einfluß auf den ganzen Menschen nimmt und unweigerlich zu einem  "Wachsen" in den yogischen Tugenden führt; letzters würde durchaus erfreulich, ja wünschenswert sein, aber wenn man es eben nicht vorher dazu sagt und ausreichend umfassend darauf eingeht, dann kann so Mancher/Manche/Manchzwi hinterher den erlernten Beruf nicht mehr ausüben oder aber, weil viele Tätigkeiten sich verbieten, sieht man sich drastisch verringerten Berufschancen ausgesetzt und dann würde man - wenn man es einem gleich gesagt gehabt haben würde - sich gleich für ein Studium der Kunst, Musik, Literatur odgl entschieden haben, aber nicht für Medizin, Pharmazie, Chemie, Forstwirstchaft, usw. Selbst Informatik kann da plötzlich Probleme bereiten, wenn man etwa an die Trittbrettfahrereien  bei der - wenn nicht gar mit Auftragsgebereien, finanzieller Unterstützungstätigkeiten für die - "Neurologie" und den "neuronalen Netzen" denkt. (Selbstverständlich kommen auch noch andere Probleme "sozialer" Verantwortung auf einen zu.) Für entsprechenden Berufsausbildungen auf der Basis einer Lehre gilt es ganz analog.

Jene, die da selber genau solche Probleme zu schaffen/riskieren, wie es Mr. Mahesh tat, keinerlei Probleme  betreffs  derer eigener Verursacherschaft sehen/sahen, maßten sich dann  auch noch an, über "TM-AnhängerInnen" herzufallen, über "TM zu urteilen", "TM'ler wegen solcher - in gewisser Weise durchaus sozialer - Probleme für verrückt zu erklären", aus dem Verkehr zu ziehen, deren eh schon durchaus erheblich verringerte Jobmöglichkeiten dann noch  per "Attributhinzufügung" "verrückt" für alle  praktischen Zwecke - vorsätzlich auch noch - auf Null zu reduzieren. Ein geräumterweise bestand und besteht die Gefahr, daß solche mangelhaft vorinformierten, vorbereiteten "Meditationsausüber", die in jene Handlungs- sowie Lebensunterhalterarbeitenkönnen-Probleme geraten bzw gerieten, dann davon ausgingen bzw ausgehen, daß eine sichere Lösung des Problems darin zu suchen sein sollte, daß man in der unmittelbaren Nähe des "Gurus" lebt und das tut, was er/sie/zwi einem aufträgt oder auch was er/sie/zwi eben so tut. So wurden  bzw werden dann am Ende teils nicht oder auch schlecht  bezahlte, sozial kaum mehr abgesicherte Handlanger, teils ärmliche Vollzeit-TM-Lehrer daraus. In München versuchte sich anno ab Ende 1972 bis ca 1975 ein Doktor der Philosophie in so einem Vollzeit-TM-Lehrer-Leben aus dem einen oder auch anderen, ehrlicheren oder auch arglistigeren Grund. Nunja über mehr als gerade so, mit sehr viel Randnähe zur Illegalität, zu überleben kam er nicht. Andere, die  er aber von deren Lebensweg abgebracht hatte, ob weil es "die Philosophie gebiete" oder auch weil er sonst sein Überleben gar nicht geschafft hätte oder aus Unwisseneheit über die Konsequenzen seines Tun&Lassens, endeten dann wie er. Na klar, wenn es jene "spirituelle" Ursächlichkeit (und mangelendes vorinformiert gewesen sein..) gewesen wäre, weil eben "ahimsa" und die anderen yogischen Tugenden sich so weit "bemerkbar gemacht hätten, hätte er als TM-Lehrer immerhin noch eigenständig sein "Überleben" geschafft; aber angesichts seiner 14-jährigen Freundin, die er in deren Alter von ca 10-12 selber initiiert gehabt hatte, gegen Ende seiner Tage in München, wage ich seine "yogischen" Gründe doch zu bezweifeln. Die Versuchung solche Hilflosigkeit infolge von zunehmendem Einfluß der yogischen Ideale, die man aufrgund mangelendem vorinformiertgewesenseins nicht zu begreifen vermag auszunutzen und Mißbrauch der einen oder auch anderen Art dann zu treiben, könnte bisweilen durchaus hoch sein und es besteht leider kein Zweifel, daß solcher Mißbrauch auch echt geschah. Dereinst lehrte Mr. Mahesh, daß man im Rahmen solcher sog. "Rundenkurse", also Kursen in deren Rahmen man mehr als jene 2-mal am Tag meditiert,. mit Beginn des Rundens keine neuen Entscheidungen treffen dürfe und man das auf das Ende des Rundens vertagen müsse. Was tat nun Mr. Mahesh selber im Rahmen des TM-Lehreausbildungskurses von Anfang März bis Anfang Mai 1973 in Playa La Antilla/Spanien? Gegen Ende trat ein, dem Dialekt nach, US-Amerikaner ans Mikrofon und sagte zu Mr. Mahesh "Wir sind mit dem Runden immer noch auf 2 + 2; sollten wir nicht herunterkommen, das Kursende naht doch" (Sinngemäß wiedergegeben und gleich ins Deutsche übersetzt; ich hatte den gesamten Kurs in der englischen Sprachgruppe mitgemacht und nur zu den Tests und zuvor den nachmittaglichen Gruppentreffen pro Erhalt des Kursmaterials, mich in die deutsche Sprachgruppe begeben.  Ein deutscher TM-Lehrer, der sich über meine Infos ärgert, hat kürzlich einige der damaligen deutschen Kursteilnehmer, die aber allesamt den Kurs in der deutschen Sprachgruppe mitgemachund also nur die deutschen Simultan-Übersetzungen erhalten hatten, danach gefragt und als Ergebnis mir mitgeteilt, daß jene von diesem Sachverhalt nichts wüßten; wie peinlich für die Übersetzer. Aber nunja, der damalige Leiter der deutschen Sprachgruppe Winfried S., wurde ja kurz danach auch gefuert, weil er dabei beobachtet worden war, wie er einem Deutschen bei der Fälschung der  Testergebnisse behilflich gewesen war, sodaß jener dann bestanden gehabt hätte obgleich der eben durchgefallen gewesen war. Alle Deutschen mußten daraufhin alle Tests nochmals machen...). Mr Mahesh's absurde oder auch hinterhältige Antwort: "Ihr seid das nun so gewohnt, ihr könnt das zuhause genauso machen und diejenigen, dier schon herunten sind mit dem Runden, können zuhause 40 Minuten morgens und abends meditieren und dazu vorher und nacher Asanas und Pranyama. Nunja, das macht dannca 40+15+10 = 65 Minuten morgens und abends und  wo ist da noch die Verträglichkeit mit einem üblichen Leben, der aus Fahrt zur Arbeit, Arbeit, Haushalt versorgen udgl besteht? Täglich über 2 Stunden, das ist dann schon etwas viel bisweilen. Außerdem wie sollte sich jemand nun plötzlich frei entscheiden, sich dafür oder auch dagegen entscheiden, wo man doch während des Rundens, solange man nicht wieder bei 1+1 angelangt ist und das Kursende erreicht wurde?

Das Ganze sah und sieht leider danach aus, daß Mr. Mahesh die Situation, "selber keine neuen Entscheidungen zu treffen, sich an die Kursroutine und das was man schon vorher gelernt hatte zu halten" zu mißbrauchen versuchte, um Anwesende unter seine "Entscheidungskontrolle" zu bringen; damit verstießen er dann krass gegen die Freiheitlichkeit; er handelte, als wollte er die TM-LehrerInnen nicht hinterher wieder sich selber und ihrer Selbstkontrolle überlassen, sondern sie "für sich behalten", "vereinnahmen". Sicherlich kann ich mir vorstellen, daß er nur naiv, fahrlässig gehandelt hatte. Aber dennoch hatte er mir damals schon unmißverständlich klar gemacht, daß er ein "formales Begreifen und sich auf Ihn verlassen" -Können in Bezug auf das was Er da so von sich gab nunmal nicht anbot. Bei allem was er so tat und redete, blieb man sich stets selber überlassen und man durfte sich grundsätzlich nicht auf ihn verlassen, da es in totaler Entscheidungs- und Handlungsunfähigkeit - zumindest bisweilen und (sind 1000 Personen auf einmal noch Einzelfälle?) in etlichen Fällen geendet hätte.

Nur was, wenn jemand nicht von Anfang an und stets eine kritische Haltung Ihm gegenüber gehabt hatte?

Nun, als Ich zum ersten Mal mit "Runden" konfrontiert worden war, da war das auf jenem Kurs mit Mr. Mahesh und Mr Satyanand in Kössen im Herbst 1972. Ich hatte nur für die mittleren 2 Wochen "gebucht" und war von der deutschen SRM-Zentrale (minderjährig, nacvh Ok der Erziehungsberechtigten fragte man auch wieder mal nicht) nunmal zugelassen worden. An der Rezeption war ein junges Mädchen, die mir einen Zettel bzgl. der Kursroutine in die Hand drückte und mir den Weg zum Quartier wies; letzteres funktionierte auch; es war ein Doppelzimmer und er Zimmergenosse war ein volljähriger Ami oder auch Brite odgl. Nun von" Runden" hatte ich nie was gehört. Ein Kusteilnehmer, den ich kannte erklärte mir die Asanas und das Pranayama etc; um von Ihm nicht abhängig zu sein, kaufte ich mir noch jenes Heftchen mit den Erläuterungen zu den Asanas und dem Pranayama. "Mein" TM-Verpasser, lief mir über den Weg, als ich - per Fahrrad (Baujahr ca 1914) von Übersee am Chiemsee aus - dort angekommen war. Er grüßte mich, berichtete mir voller Stolz, daß er jetzt sein Studium erfolgreich beenden habe können und überließ mich ansonsten meinem Schicksal; na klar wußte er genau, daß Er mir jenes "Runden" nie beigebracht hatte, aber er war eben in seinem "Runden-Suri". Nun, es hieß auf dem Zettel 2+2 und so machte ich vor der Abfahrt per Fahrrad, dann noch  2 Runden am Morgen und als ich zuhause war, war da der Lärm, das Gestank und die vergiftete Luft der Großstadt München, was dann ein ziemlicher Schock gewesen war, sodaß ich eilends beschloß erst noch1 Tag lang 2+2 zu machen und dann allmählich auf 1+1 herunterzukommen; es dauerte ca 2-3 Tage bis ich mich wieder an die "Großstadt" gewöhnt h